UCP1 Recombinant monoclonal antibody

• 

  WB analysis of mouse brown adipose using 83870-1-RR

  mouse brown adipose tissue were subjected to SDS PAGE followed by western blot with 83870-1-RR (UCP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of rat brain using 83870-1-RR

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 83870-1-RR (UCP1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 83870-1-RR

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 83870-1-RR (UCP1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse brown adipose using 83870-1-RR

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brown adipose tissue using UCP1 antibody (83870-1-RR, Clone: 240782F3 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse brown adipose using 83870-1-RR

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brown adipose tissue using UCP1 antibody (83870-1-RR, Clone: 240782F3 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity and Kinetic Characterization of 83870-1-RR

  Biolayer interferometry (BLl) kinetic assays of 83870-1-RR against Human UCP1 were performed. The affinity constant is 64.6 nM.

UCP1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, ELISA

Cat No. 83870-1-RR

Clone No.240782F3

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, ELISA

Synonyms

240782F3, SLC25A7, Thermogenin, UCP, UCP 1

---

Tested Applications

• Positive WB detected in: mouse brown adipose tissue
• Positive IHC detected in: rat brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse brown adipose tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83870-1-RR targets UCP1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag20388

  Product name: Recombinant human UCP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-307 aa of BC098168

  Sequence: MGGLTASDVHPTLGVQLFSAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEGRMKLYSGLPAGLQRQISSASLRIGLYDTVQEFLTAGKETAPSLGSKILAGLTTGGVAVFIGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINCTELVTYDLMKEAFVKNNILADDVPCHLVSALIAGFCATAMSSPVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKRELSKSRQTMDCAT

• Full Name: uncoupling protein 1 (mitochondrial, proton carrier)
• Calculated Molecular Weight: 307 aa, 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC098168
• Gene Symbol: UCP1
• Gene ID (NCBI): 7350
• RRID: AB_3671456
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P25874
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

UCP-1 (Mitochondrial uncoupling protein 1), is a mitochondrial transporter protein that creates proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. It has been identified a key molecule for metabolic thermogenesis to avoid an excess of fat accumulation. UCP-1 expression is usually restricted to brown adipose when induced by cold exposure and thyroid hormone.

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Daniel (Verified Customer) (10-29-2025)

The antibody works great, I can recommend it

• Applications: Immunohistochemistry
• Primary Antibody Dilution: IHC-F 1:500
• Cell Tissue Type: mouse brown adipose tissue sections