Tested Applications
Positive WB detected in | fetal human brain tissue, PC-3 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
25223-1-AP targets UCP5 in WB, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag18661 Product name: Recombinant human SLC25A14 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 2-111 aa of BC119666 Sequence: GIFPGIILIFLRVKFATAAVIVSGHQKSTTVSHEMSGLNWKPFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGVLALYSGIAPAL Predict reactive species |
Full Name | solute carrier family 25 (mitochondrial carrier, brain), member 14 |
Calculated Molecular Weight | 325 aa, 36 kDa |
Observed Molecular Weight | 36-40 kDa |
GenBank Accession Number | BC119666 |
Gene Symbol | UCP5 |
Gene ID (NCBI) | 9016 |
RRID | AB_2879971 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O95258 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
UCP5, also known as BMCP1 (brain mitochondrial carrier protein-1), is a member of uncoupling proteins (UCPs) that catalyze proton leaks across the inner mitochondrial membrane, thus uncoupling fuel oxidation from ATP synthesis. UCPs are implicated in metabolic rate and adaptational thermoregulation. UCP5 is widely expressed with high abundance in brain and testis. Alternative splicing generates several isoforms of UCP5.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for UCP5 antibody 25223-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |