Product Information
25223-1-PBS targets UCP5 in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18661 Product name: Recombinant human SLC25A14 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 2-111 aa of BC119666 Sequence: GIFPGIILIFLRVKFATAAVIVSGHQKSTTVSHEMSGLNWKPFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGVLALYSGIAPAL Predict reactive species |
| Full Name | solute carrier family 25 (mitochondrial carrier, brain), member 14 |
| Calculated Molecular Weight | 325 aa, 36 kDa |
| Observed Molecular Weight | 36-40 kDa |
| GenBank Accession Number | BC119666 |
| Gene Symbol | UCP5 |
| Gene ID (NCBI) | 9016 |
| RRID | AB_2879971 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O95258 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
UCP5, also known as BMCP1 (brain mitochondrial carrier protein-1), is a member of uncoupling proteins (UCPs) that catalyze proton leaks across the inner mitochondrial membrane, thus uncoupling fuel oxidation from ATP synthesis. UCPs are implicated in metabolic rate and adaptational thermoregulation. UCP5 is widely expressed with high abundance in brain and testis. Alternative splicing generates several isoforms of UCP5.



