UGCGL2 Polyclonal antibody, PBS Only

• 

  WB analysis using 13420-1-AP (same clone as 13420-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13420-1-AP (UGCGL2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13420-1-PBS in a different storage buffer formulation.

UGCGL2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 13420-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

EC:2.4.1.-, hUGT2, UDP--Glc:glycoprotein glucosyltransferase 2, UDP-glucose ceramide glucosyltransferase-like 1, UDP-glucose:glycoprotein glucosyltransferase 2

---

Product Information

13420-1-PBS targets UGCGL2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4189

  Product name: Recombinant human UGCGL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-278 aa of BC032302

  Sequence: MAPAKATNVVRLLLGSTALWLSQLGSGTVAASKSVTAHLAAKWPETPLLLEASEFMAEESNEKFWQFLETVQELAIYKQTESDYSYYNLILKKAGQFLDNLHINLLKFAFSIRAYSPAIQMFQQIAADEPPPDGCNAFVVIHKKHTCKINEIKKLLKKAASRTRPYLFKGDHKFPTNKENLPVVILYAEMGTRTFSAFHKVLSEKAQNEEILYVLRHYIQKPSSRKMYLSGYGVELAIKSTEYKALDDTQVKTVTNTTVEDETETNEVQGFLFGKLKS

• Full Name: UDP-glucose ceramide glucosyltransferase-like 2
• Calculated Molecular Weight: 1516 aa, 168 kDa
• Observed Molecular Weight: 170 kDa
• GenBank Accession Number: BC032302
• Gene Symbol: UGCGL2
• Gene ID (NCBI): 55757
• RRID: AB_10644120
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NYU1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

UGCGL2 (UDP-glucose glycoprotein glucosyl transferase like 2) attaches a single glucose residue from/to the Man9GlcNAc2 glycan of incompletely folded or misfolded amino acid sequences. UGCGL2 exhibits higher levels in kidney, pancreas, heart, and skeletal muscle.