UGCGL2 Polyclonal antibody

• 

  WB analysis using 13420-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13420-1-AP (UGCGL2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

UGCGL2 Polyclonal Antibody for WB, ELISA

Cat No. 13420-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

EC:2.4.1.-, hUGT2, UDP--Glc:glycoprotein glucosyltransferase 2, UDP-glucose ceramide glucosyltransferase-like 1, UDP-glucose:glycoprotein glucosyltransferase 2

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13420-1-AP targets UGCGL2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4189

  Product name: Recombinant human UGCGL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-278 aa of BC032302

  Sequence: MAPAKATNVVRLLLGSTALWLSQLGSGTVAASKSVTAHLAAKWPETPLLLEASEFMAEESNEKFWQFLETVQELAIYKQTESDYSYYNLILKKAGQFLDNLHINLLKFAFSIRAYSPAIQMFQQIAADEPPPDGCNAFVVIHKKHTCKINEIKKLLKKAASRTRPYLFKGDHKFPTNKENLPVVILYAEMGTRTFSAFHKVLSEKAQNEEILYVLRHYIQKPSSRKMYLSGYGVELAIKSTEYKALDDTQVKTVTNTTVEDETETNEVQGFLFGKLKS

• Full Name: UDP-glucose ceramide glucosyltransferase-like 2
• Calculated Molecular Weight: 1516 aa, 168 kDa
• Observed Molecular Weight: 170 kDa
• GenBank Accession Number: BC032302
• Gene Symbol: UGCGL2
• Gene ID (NCBI): 55757
• RRID: AB_10644120
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NYU1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

UGCGL2 (UDP-glucose glycoprotein glucosyl transferase like 2) attaches a single glucose residue from/to the Man9GlcNAc2 glycan of incompletely folded or misfolded amino acid sequences. UGCGL2 exhibits higher levels in kidney, pancreas, heart, and skeletal muscle.