UGT3A2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• UGT3A2 Polyclonal antibody (21366-1-AP)

UGT3A2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 21366-1-AP Copied!

Publications (1)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

UDPGT 3A2, UGT3A2, UNQ842/PRO1780

• 

  WB analysis using 21366-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21366-1-AP (UGT3A2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human testis using 21366-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 21366-1-AP (UGT3A2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 21366-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 21366-1-AP (UGT3A2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 21366-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 21366-1-AP (UGT3A2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for UGT3A2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: MOLT-4 cells, human testis tissue, THP-1 cells
• Positive IHC detected in: mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21366-1-AP targets UGT3A2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15835

  Product name: Recombinant human UGT3A2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 75-129 aa of BC103925

  Sequence: QVISWLAPEDHQREFKKSFDFFLEETLGGRGKFENLLNVLEYLALQCSHFLNRKD

• Full Name: UDP glycosyltransferase 3 family, polypeptide A2
• Calculated Molecular Weight: 523 aa, 60 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC103925
• Gene Symbol: UGT3A2
• Gene ID (NCBI): 167127
• RRID: AB_10888629
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q3SY77
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The UGT3A2 Polyclonal antibody (Cat# 21366-1-AP) has 1 total citation. The cited publication appeared in Frontiers in Molecular Biosciences (2023) and focused on identifying small extracellular vesicle protein biomarkers for pediatric Ewing Sarcoma, using the antibody for IHC. The research field encompasses cancer biomarker discovery, extracellular vesicle biology, and pediatric oncology.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	IHC	Front Mol Biosci; Identification of small extracellular vesicle protein biomarkers for pediatric Ewing Sarcoma; Authors - Soumya M Turaga

Reviews

3.0 out of 5

1 verified customer reviews

What customers say

The single review for this antibody reports a 3-star rating. The user tested it at a 1:500 dilution on HeLa and MT4 cells for Western Blot and noted that while the antibody does work, it produces high background. Overall, the feedback suggests the product is functional but may require optimization (e.g., adjusting dilution or blocking conditions) to reduce nonspecific signal.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Daniel (Verified Customer) (10-26-2022)

This antibody works but produces high background.

• Applications: Western Blot
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: HeLa, MT4 cells

UGT3A2 Antibody Western Blot validation (1:500 dilution) in HeLa, MT4 cells (Cat no:21366-1-AP)