Tested Applications
Positive WB detected in | MOLT-4 cells, human testis tissue, THP-1 cells |
Positive IHC detected in | mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
IHC | See 1 publications below |
Product Information
21366-1-AP targets UGT3A2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag15835 Product name: Recombinant human UGT3A2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 75-129 aa of BC103925 Sequence: QVISWLAPEDHQREFKKSFDFFLEETLGGRGKFENLLNVLEYLALQCSHFLNRKD Predict reactive species |
Full Name | UDP glycosyltransferase 3 family, polypeptide A2 |
Calculated Molecular Weight | 523 aa, 60 kDa |
Observed Molecular Weight | 50-55 kDa |
GenBank Accession Number | BC103925 |
Gene Symbol | UGT3A2 |
Gene ID (NCBI) | 167127 |
RRID | AB_10888629 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q3SY77 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for UGT3A2 antibody 21366-1-AP | Download protocol |
IHC protocol for UGT3A2 antibody 21366-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Daniel (Verified Customer) (10-26-2022) | This antibody works but produces high background.
![]() |