Tested Applications
| Positive IF/ICC detected in | MDCK cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
| IHC | See 1 publications below |
Product Information
13065-1-AP targets UNC119 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, canine samples.
| Tested Reactivity | human, canine |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3757 Product name: Recombinant human UNC119 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-240 aa of BC027176 Sequence: MKVKKGGGGAGTATESAPGPSGQSVAPIPQPPAESESGSESEPDAGPGPRPGPLQRKQPIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSGTP Predict reactive species |
| Full Name | unc-119 homolog (C. elegans) |
| Calculated Molecular Weight | 240 aa, 27 kDa |
| GenBank Accession Number | BC027176 |
| Gene Symbol | UNC119 |
| Gene ID (NCBI) | 9094 |
| RRID | AB_2877911 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13432 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Human UNC119 protein shares strong homology with the C. elegans unc119 protein which was first discovered in C. elegans on the basis of a spontaneous mutation affecting locomotion, feeding behavior and chemosensation. UNC119 is predominantly expressed in retina, in photoreceptor synapses and inner segments, with much lower expression in several other tissues. UNC119 is involved in the mechanism of photoreceptor neurotransmitter release through the synaptic vesicle cycle. It is required for G protein trafficking in sensory neurons.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for UNC119 antibody 13065-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Life Sci Alliance UNC119 regulates T-cell receptor signalling in primary T cells and T acute lymphocytic leukaemia |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Francesc R (Verified Customer) (06-14-2022) | Antibody works nicely by Western blot, specifically recognizing band of roughly the expected size. Attached image shows blot of CRISPR clones: four still contain UNC119 and all the others without the band are the UNC119-KO clones.
![]() |


