Tested Applications
| Positive WB detected in | mouse spleen tissue, rat kidney tissue, rat spleen tissue, pig spleen tissue |
| Positive IHC detected in | human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
Product Information
28359-1-AP targets UNC93B1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27937 Product name: Recombinant human UNC93B1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-109 aa of BC101568 Sequence: MEAEPPLYPMAGAAGPQGDEDLLGVPDGPEAPLDELVGAYPNYNEEEEERRYYRRKRLGVLKNVLAASAGGMLTYGVYLGLLQMQLILHYDETYREVKYGNMGLPDIDS Predict reactive species |
| Full Name | unc-93 homolog B1 (C. elegans) |
| Calculated Molecular Weight | 597 aa, 67 kDa |
| Observed Molecular Weight | ~70 kDa |
| GenBank Accession Number | BC101568 |
| Gene Symbol | UNC93B1 |
| Gene ID (NCBI) | 81622 |
| RRID | AB_3086046 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H1C4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Unc-93 homolog B1 (UNC93B1) is a key regulator of nucleic acid (NA)-sensing Toll-like receptors (TLRs). UNC93B1 plays an important role in innate and adaptive immunity by regulating nucleotide-sensing Toll-like receptor (TLR) signaling. It's a transmembrane protein that is known to control the movement of TLRs from the endoplasmic reticulum-where TLRs are assembled-to endosomes. The calculated MW of UNC93B1 is 66 kDa, 28359-1-AP can detect a band around 70 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for UNC93B1 antibody 28359-1-AP | Download protocol |
| WB protocol for UNC93B1 antibody 28359-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



