UNC93B1 Polyclonal antibody

• 

  WB analysis using 28359-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28359-1-AP (UNC93B1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary cancer using 28359-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 28359-1-AP (UNC93B1 antibody) at dilution of 1:100 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

UNC93B1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28359-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, ELISA

Synonyms

UNC93, Unc 93B1, unc 93 homolog B1 (C. elegans), Protein unc-93 homolog B1, Protein unc 93 homolog B1

---

Tested Applications

• Positive WB detected in: mouse spleen tissue, rat kidney tissue, rat spleen tissue, pig spleen tissue
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

28359-1-AP targets UNC93B1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27937

  Product name: Recombinant human UNC93B1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-109 aa of BC101568

  Sequence: MEAEPPLYPMAGAAGPQGDEDLLGVPDGPEAPLDELVGAYPNYNEEEEERRYYRRKRLGVLKNVLAASAGGMLTYGVYLGLLQMQLILHYDETYREVKYGNMGLPDIDS

• Full Name: unc-93 homolog B1 (C. elegans)
• Calculated Molecular Weight: 597 aa, 67 kDa
• Observed Molecular Weight: ~70 kDa
• GenBank Accession Number: BC101568
• Gene Symbol: UNC93B1
• Gene ID (NCBI): 81622
• RRID: AB_3086046
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H1C4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Unc-93 homolog B1 (UNC93B1) is a key regulator of nucleic acid (NA)-sensing Toll-like receptors (TLRs). UNC93B1 plays an important role in innate and adaptive immunity by regulating nucleotide-sensing Toll-like receptor (TLR) signaling. It's a transmembrane protein that is known to control the movement of TLRs from the endoplasmic reticulum-where TLRs are assembled-to endosomes. The calculated MW of UNC93B1 is 66 kDa, 28359-1-AP can detect a band around 70 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	J Nanobiotechnology; Engineered endoplasmic reticulum-targeting nanodrugs with Piezo1 inhibition and promotion of cell uptake for subarachnoid hemorrhage inflammation repair; Authors - Xiaojian Zhang