Tested Applications
| Positive IP detected in | mouse bladder tissue |
| Positive IHC detected in | human bladder tissue, rat bladder tissue, mouse bladder tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:2500-1:10000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| IHC | See 1 publications below |
| IF | See 1 publications below |
Product Information
25275-1-AP targets UPK1A in IP, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17356 Product name: Recombinant human UPK1A protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 111-230 aa of BC107098 Sequence: CITSYTHRDYMVSNPSLITKQMLTFYSADTDQGQELTRLWDRVMIEQECCGTSGPMDWVNFTSAFRAATPEVVFPWPPLCCRRTGNFIPLNEEGCRLGHMDYLFTKGCFEHIGHAIDSYT Predict reactive species |
| Full Name | uroplakin 1A |
| Calculated Molecular Weight | 258 aa, 29 kDa |
| Observed Molecular Weight | 29 kDa |
| GenBank Accession Number | BC107098 |
| Gene Symbol | UPK1A |
| Gene ID (NCBI) | 11045 |
| RRID | AB_2880000 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O00322 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Uroplakins are a group of urothelial differentiation-related membrane proteins. They are components of the asymmetric unit membrane (AUM), which forms the apical plaques of mammalian urothelium and is believed to play a role in strengthening the urothelial apical surface thus preventing the cells from rupturing during bladder distention (PMID: 8175808). Uroplakin-1a (UPK1A) belongs to the tetraspanin (TM4SF) family. UPK1A plays an important role in normal bladder epithelial physiology, possibly in regulating membrane permeability of superficial umbrella cells or in stabilizing the apical membrane.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for UPK1A antibody 25275-1-AP | Download protocol |
| IP protocol for UPK1A antibody 25275-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Stem Cells Int Pyridoxal-5'-Phosphate Promotes Immunomodulatory Function of Adipose-Derived Mesenchymal Stem Cells through Indoleamine 2,3-Dioxygenase-1 and TLR4/NF-κB Pathway. | ||
Int J Urol Differential effects of adipose tissue stromal cells on the apoptosis, growth and invasion of bladder urothelial carcinoma between the superficial and invasive types. |













