UPK1B Polyclonal antibody, PBS Only

• 

  IHC staining of human urothelial carcinoma using 26853-1-AP (same clone as 26853-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 26853-1-AP (UPK1B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26853-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human urothelial carcinoma using 26853-1-AP (same clone as 26853-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 26853-1-AP (UPK1B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26853-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse bladder using 26853-1-AP (same clone as 26853-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse bladder tissue slide using 26853-1-AP (UPK1B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26853-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse bladder using 26853-1-AP (same clone as 26853-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse bladder tissue slide using 26853-1-AP (UPK1B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26853-1-PBS in a different storage buffer formulation.

UPK1B Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 26853-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

26853-1-PBS targets UPK1B in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25471

  Product name: Recombinant human UPK1B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 108-229 aa of BC063568

  Sequence: TAATQRDFFTPNLFLKQMLERYQNNSPPNNDDQWKNNGVTKTWDRLMLQDNCCGVNGPSDWQKYTSAFRTENNDADYPWPRQCCVMNNLKEPLNLEACKLGVPGFYHNQGCYELISGPMNRH

• Full Name: uroplakin 1B
• GenBank Accession Number: BC063568
• Gene Symbol: UPK1B
• Gene ID (NCBI): 7348
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75841
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Uroplakins are a group of urothelial differentiation-related membrane proteins. They are components of the asymmetric unit membrane (AUM), which forms the apical plaques of mammalian urothelium and is believed to play a role in strengthening the urothelial apical surface thus preventing the cells from rupturing during bladder distention (PMID: 8175808). Uroplakin-1B (UPK1B) belongs to the tetraspanin (TM4SF) family. UPK1B can promote the proliferation, invasion and metastasis of tumor cells and regulate the development and progression of tumors (PMID: 30229818).