Tested Applications
| Positive WB detected in | HEK-293 cells |
| Positive IHC detected in | human liver cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 3 publications below |
Product Information
25781-1-AP targets UQCC2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22710 Product name: Recombinant human C6orf125 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-126 aa of BC006007 Sequence: MAASRYRRFLKLCEEWPVDETKRGRDLGAYLRQRVAQAFREGENTQVAEPEACDQMYESLARLHSNYYKHKYPRPRDTSFSGLSLEEYKLILSTDTLEELKEIDKGMWKKLQEKFAPKGPEEDHKA Predict reactive species |
| Full Name | chromosome 6 open reading frame 125 |
| Calculated Molecular Weight | 126 aa, 15 kDa |
| Observed Molecular Weight | 14 kDa |
| GenBank Accession Number | BC006007 |
| Gene Symbol | UQCC2 |
| Gene ID (NCBI) | 84300 |
| RRID | AB_2880237 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BRT2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
UQCC2, also named as C6orf125, MNF1, Mitochondrial protein M19 and Breast cancer-associated protein SGA-81M, plays a role in the modulation of respiratory chain activities. It's a mitochondrial protein.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for UQCC2 antibody 25781-1-AP | Download protocol |
| IHC protocol for UQCC2 antibody 25781-1-AP | Download protocol |
| WB protocol for UQCC2 antibody 25781-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Oxid Med Cell Longev Combined Respiratory Chain Deficiency and UQCC2 Mutations in Neonatal Encephalomyopathy: Defective Supercomplex Assembly in Complex III Deficiencies. | ||
iScience Deficient tRNA posttranscription modification dysregulated the mitochondrial quality controls and apoptosis |











