UQCC2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• UQCC2 Polyclonal antibody (25781-1-AP)

UQCC2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 25781-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

C6orf125, Breast cancer-associated protein SGA-81M, Mitochondrial nucleoid factor 1, Mitochondrial protein M19, MNF1

• 

  WB analysis of HEK-293 using 25781-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 25781-1-AP (UQCC2 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 25781-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 25781-1-AP (UQCC2 antibody at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 25781-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 25781-1-AP (UQCC2 antibody at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 25781-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 25781-1-AP (UQCC2 antibody at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 25781-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 25781-1-AP (UQCC2 antibody at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 25781-1-AP

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using UQCC2 antibody (25781-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for UQCC2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells
• Positive IHC detected in: human liver cancer tissue, human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25781-1-AP targets UQCC2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22710

  Product name: Recombinant human C6orf125 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-126 aa of BC006007

  Sequence: MAASRYRRFLKLCEEWPVDETKRGRDLGAYLRQRVAQAFREGENTQVAEPEACDQMYESLARLHSNYYKHKYPRPRDTSFSGLSLEEYKLILSTDTLEELKEIDKGMWKKLQEKFAPKGPEEDHKA

• Full Name: chromosome 6 open reading frame 125
• Calculated Molecular Weight: 126 aa, 15 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC006007
• Gene Symbol: UQCC2
• Gene ID (NCBI): 84300
• RRID: AB_2880237
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BRT2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

UQCC2, also named as C6orf125, MNF1, Mitochondrial protein M19 and Breast cancer-associated protein SGA-81M, plays a role in the modulation of respiratory chain activities. It's a mitochondrial protein.

Publications

What published studies show

The UQCC2 Polyclonal antibody (Cat# 25781-1-AP) has 3 total citations. These appear in Cell Reports, Oxidative Medicine and Cellular Longevity, and iScience. The associated research fields include mitochondrial fission and mitotic progression, respiratory chain deficiency and supercomplex assembly, and tRNA posttranscriptional modification with mitochondrial quality control and apoptosis. All citations used Western blot (WB) as the application.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell Rep; A PKD-MFF signaling axis couples mitochondrial fission to mitotic progression.; Authors - Evanthia Pangou
human	WB	Oxid Med Cell Longev; Combined Respiratory Chain Deficiency and UQCC2 Mutations in Neonatal Encephalomyopathy: Defective Supercomplex Assembly in Complex III Deficiencies.; Authors - René G Feichtinger
human	WB	iScience; Deficient tRNA posttranscription modification dysregulated the mitochondrial quality controls and apoptosis; Authors - Yunfan He