Tested Applications
Positive WB detected in | mouse heart tissue, rat heart tissue |
Positive IP detected in | mouse heart tissue |
Positive IHC detected in | human breast cancer tissue, human kidney tissue, human ovary tumor tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 15 publications below |
IHC | See 1 publications below |
Product Information
10756-1-AP targets UQCRB in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag1127 Product name: Recombinant human UQCRB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-111 aa of BC005230 Sequence: MAGKQAVSASGKWLDGIRKWYYNAAGFNKLGLMRDDTIYEDEDVKEAIRRLPENLYNDRMFRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKK Predict reactive species |
Full Name | ubiquinol-cytochrome c reductase binding protein |
Calculated Molecular Weight | 14 kDa |
Observed Molecular Weight | 14 kDa |
GenBank Accession Number | BC005230 |
Gene Symbol | UQCRB |
Gene ID (NCBI) | 7381 |
RRID | AB_2304256 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P14927 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
UQCRB(ubiquinol-cytochrome c reductase binding protein) is also named as UQBP, complex III subunit VII and belongs to the UQCRB/QCR7 family. It is a 13.4 kDa subunit of mitochondrial complex III, plays a crucial role in hypoxia-induced angiogenesis via mitochondrial reactive oxygen species (ROS)-mediated signaling(PMID:21215626). This protein has 2 isoforms produced by alternative splicing.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for UQCRB antibody 10756-1-AP | Download protocol |
IHC protocol for UQCRB antibody 10756-1-AP | Download protocol |
IP protocol for UQCRB antibody 10756-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Mol Cell TTC19 Plays a Husbandry Role on UQCRFS1 Turnover in the Biogenesis of Mitochondrial Respiratory Complex III. | ||
Sci Adv Mitochondrial respiration controls the Prox1-Vegfr3 feedback loop during lymphatic endothelial cell fate specification and maintenance.
| ||
Nat Chem Biol Peroxisomal-derived ether phospholipids link nucleotides to respirasome assembly. | ||
Neurobiol Aging Up-regulation of key microRNAs, and inverse down-regulation of their predicted oxidative phosphorylation target genes, during aging in mouse brain. |