Tested Applications
| Positive WB detected in | mouse heart tissue, rat heart tissue |
| Positive IP detected in | mouse heart tissue |
| Positive IHC detected in | human breast cancer tissue, human kidney tissue, human ovary tumor tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10756-1-AP targets UQCRB in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1127 Product name: Recombinant human UQCRB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-111 aa of BC005230 Sequence: MAGKQAVSASGKWLDGIRKWYYNAAGFNKLGLMRDDTIYEDEDVKEAIRRLPENLYNDRMFRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKK Predict reactive species |
| Full Name | ubiquinol-cytochrome c reductase binding protein |
| Calculated Molecular Weight | 14 kDa |
| Observed Molecular Weight | 14 kDa |
| GenBank Accession Number | BC005230 |
| Gene Symbol | UQCRB |
| Gene ID (NCBI) | 7381 |
| RRID | AB_2304256 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P14927 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
UQCRB(ubiquinol-cytochrome c reductase binding protein) is also named as UQBP, complex III subunit VII and belongs to the UQCRB/QCR7 family. It is a 13.4 kDa subunit of mitochondrial complex III, plays a crucial role in hypoxia-induced angiogenesis via mitochondrial reactive oxygen species (ROS)-mediated signaling(PMID:21215626). This protein has 2 isoforms produced by alternative splicing.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for UQCRB antibody 10756-1-AP | Download protocol |
| IHC protocol for UQCRB antibody 10756-1-AP | Download protocol |
| IP protocol for UQCRB antibody 10756-1-AP | Download protocol |
| WB protocol for UQCRB antibody 10756-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The UQCRB Polyclonal antibody (Cat# 10756-1-AP) has 18 citations published in journals including Nature Metabolism, Nature Communications, Cell Metabolism, Cell Stem Cell, Molecular Cell, Nature Chemical Biology, Science Advances, Free Radical Biology and Medicine, Brain Pathology, Neurobiology of Aging, and others. Research fields span mitochondrial biology, oxidative phosphorylation, lipid metabolism, neurodegeneration, heart regeneration, lymphatic development, osteoporosis, glioma, breast cancer, and aging.
| Species | Application | Title |
|---|---|---|
Cell Stem Cell Context-dependent roles of mitochondrial LONP1 in orchestrating the balance between airway progenitor versus progeny cells | ||
Nat Commun N-Acetyltransferase 10 represses Uqcr11 and Uqcrb independently of ac4C modification to promote heart regeneration | ||
Mol Cell TTC19 Plays a Husbandry Role on UQCRFS1 Turnover in the Biogenesis of Mitochondrial Respiratory Complex III. |
