UQCRB Polyclonal antibody

• 

  WB analysis using 10756-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10756-1-AP (UQCRB antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse heart using 10756-1-AP

  IP result of anti-UQCRB (IP:10756-1-AP, 3ug; Detection:10756-1-AP 1:600) with mouse heart tissue lysate 3200ug.

• 

  IHC staining of human breast cancer using 10756-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10756-1-AP (UQCRB antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 10756-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10756-1-AP (UQCRB antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary tumor using 10756-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 10756-1-AP (UQCRB antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary tumor using 10756-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 10756-1-AP (UQCRB antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 10756-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 10756-1-AP (UQCRB Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human kidney using 10756-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 10756-1-AP (UQCRB Antibody) at dilution of 1:50 (under 40x lens).

• Featured Product
• KD/KO Validated

UQCRB Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 10756-1-AP

Publications(16)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

Complex III subunit 7, Complex III subunit VII, QCR7, QP C, QPC, UQBC, UQBP, UQCRB, UQPC

---

Tested Applications

• Positive WB detected in: mouse heart tissue, rat heart tissue
• Positive IP detected in: mouse heart tissue
• Positive IHC detected in: human breast cancer tissue, human kidney tissue, human ovary tumor tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 15 publications below
• IHC: See 1 publications below

Product Information

10756-1-AP targets UQCRB in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1127

  Product name: Recombinant human UQCRB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-111 aa of BC005230

  Sequence: MAGKQAVSASGKWLDGIRKWYYNAAGFNKLGLMRDDTIYEDEDVKEAIRRLPENLYNDRMFRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKK

• Full Name: ubiquinol-cytochrome c reductase binding protein
• Calculated Molecular Weight: 14 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC005230
• Gene Symbol: UQCRB
• Gene ID (NCBI): 7381
• RRID: AB_2304256
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P14927
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

UQCRB(ubiquinol-cytochrome c reductase binding protein) is also named as UQBP, complex III subunit VII and belongs to the UQCRB/QCR7 family. It is a 13.4 kDa subunit of mitochondrial complex III, plays a crucial role in hypoxia-induced angiogenesis via mitochondrial reactive oxygen species (ROS)-mediated signaling(PMID:21215626). This protein has 2 isoforms produced by alternative splicing.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell; TTC19 Plays a Husbandry Role on UQCRFS1 Turnover in the Biogenesis of Mitochondrial Respiratory Complex III.; Authors - Emanuela Bottani
human	WB	Cell Metab; Mitochondrial complex III ROS regulate adipocyte differentiation.; Authors - Tormos Kathryn V KV
		Sci Adv; Mitochondrial respiration controls the Prox1-Vegfr3 feedback loop during lymphatic endothelial cell fate specification and maintenance.; Authors - Wanshu Ma ; KO Validated
human	WB	Nat Chem Biol; Peroxisomal-derived ether phospholipids link nucleotides to respirasome assembly.; Authors - Christopher F Bennett
mouse	WB	Nat Commun; Hepatic HuR modulates lipid homeostasis in response to high-fat diet.; Authors - Zhuojun Zhang
mouse	WB	Neurobiol Aging; Up-regulation of key microRNAs, and inverse down-regulation of their predicted oxidative phosphorylation target genes, during aging in mouse brain.; Authors - Li Na N