UQCRC2 Polyclonal antibody, PBS Only

• 

  WB analysis using 14742-1-AP (same clone as 14742-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14742-1-AP (UQCRC2 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14742-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human colon using 14742-1-AP (same clone as 14742-1-PBS)

  human colon tissue were subjected to SDS PAGE followed by western blot with 14742-1-AP (UQCRC2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14742-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 14742-1-AP (same clone as 14742-1-PBS)

  IP result of anti-UQCRC2 (IP:14742-1-AP, 4ug; Detection:14742-1-AP 1:40000) with HeLa cells lysate 1320 ug. This data was developed using the same antibody clone with 14742-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 14742-1-AP (same clone as 14742-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 14742-1-AP (UQCRC2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14742-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 14742-1-AP (same clone as 14742-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 14742-1-AP (UQCRC2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14742-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 14742-1-AP (same clone as 14742-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 14742-1-AP (UQCRC2 antibody) at dilution of 1:1200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14742-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 14742-1-AP (same clone as 14742-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 14742-1-AP (UQCRC2 antibody) at dilution of 1:100 and CoraLite488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L); Phalloidin stains F-actin (Red). This data was developed using the same antibody clone with 14742-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 14742-1-AP (same clone as 14742-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using UQCRC2 antibody (14742-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 14742-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 14742-1-AP (same clone as 14742-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 14742-1-AP (UQCRC2 antibody) at dilution of 1:100 and CoraLite488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 14742-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

UQCRC2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 14742-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

14742-1-PBS targets UQCRC2 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6432

  Product name: Recombinant human UQCRC2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 103-453 aa of BC000484

  Sequence: IEAVGGKLSVTATRENMAYTVECLRGDVDILMEFLLNVTTAPEFRRWEVADLQPQLKIDKAVAFQNPQTHVIENLHAAAYRNALANPLYCPDYRIGKVTSEELHYFVQNHFTSARMALIGLGVSHPVLKQVAEQFLNMRGGLGLSGAKANYRGGEIREQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGPHVKRGSNTTSHLHQAVAKATQQPFDVSAFNASYSDSGLFGIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSVESSECFLEEVGSQALVAGSYMPPSTVLQQIDSVANADIINAAKKFVSGQKSMAASGNLGHTPFVDEL

• Full Name: ubiquinol-cytochrome c reductase core protein II
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC000484
• Gene Symbol: UQCRC2
• Gene ID (NCBI): 7385
• RRID: AB_2241442
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P22695
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

UQCRC2(Ubiquinol-cytochrome-c reductase complex core protein 2) is also named as complex III subunit 2,core protein II and belongs to the UQCRC2/QCR2 subfamily. The bc1 complex contains 11 subunits: 3 respiratory subunits (cytochrome b, cytochrome c1 and Rieske/UQCRFS1), 2 core proteins (UQCRC1/QCR1 and UQCRC2/QCR2) and 6 low-molecular weight proteins (UQCRH/QCR6, UQCRB/QCR7, UQCRQ/QCR8, UQCR10/QCR9, UQCR11/QCR10 and a cleavage product of Rieske/UQCRFS1) and is part of the mitochondrial respiratory chain. This protein distributes in mitochondrion inner membrane, peripheral membrane protein and matrix side.