URM1 Polyclonal antibody

• 

  WB analysis using 15285-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15285-1-AP (URM1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human placenta using 15285-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 15285-1-AP (URM1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 15285-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 15285-1-AP (URM1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 15285-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 15285-1-AP (URM1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 15285-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 15285-1-AP (URM1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 15285-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 15285-1-AP (URM1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 15285-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 15285-1-AP (URM1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HepG2 using 15285-1-AP

  IP result of anti-URM1 (IP:15285-1-AP, 4ug; Detection:15285-1-AP 1:500) with HepG2 cells lysate 3360 ug.

• 

  IHC staining of mouse liver using 15285-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 15285-1-AP (URM1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 15285-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 15285-1-AP (URM1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human hepatocirrhosis using 15285-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 15285-1-AP (URM1 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human hepatocirrhosis using 15285-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 15285-1-AP (URM1 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human liver using 15285-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 15285-1-AP (URM1 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human liver using 15285-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 15285-1-AP (URM1 antibody) at dilution of 1:100 (under 40x lens).

• Featured Product
• KD/KO Validated

URM1 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 15285-1-AP

Publications(2)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, IHC, ELISA

Synonyms

C9orf74, URM1

---

Tested Applications

• Positive WB detected in: A549 cells, HepG2 cells, mouse liver tissue, human placenta tissue
• Positive IP detected in: HepG2 cells
• Positive IHC detected in: mouse liver tissue, human hepatocirrhosis tissue, human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below

Product Information

15285-1-AP targets URM1 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7448

  Product name: Recombinant human URM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-101 aa of BC003581

  Sequence: MAAPLSVEVEFGGGAELLFDGIKKHRVTLPGQEEPWDIRNLLIWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSVLFISTLHGG

• Full Name: ubiquitin related modifier 1 homolog (S. cerevisiae)
• Calculated Molecular Weight: 11 kDa
• Observed Molecular Weight: 11 kDa
• GenBank Accession Number: BC003581
• Gene Symbol: URM1
• Gene ID (NCBI): 81605
• RRID: AB_2213808
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BTM9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell Biol; Human AlkB homolog ABH8 Is a tRNA methyltransferase required for wobble uridine modification and DNA damage survival.; Authors - Fu Dragony D ; KD Validated
human	WB	Hum Mol Genet; Cytosolic HSC20 integrates de novo iron-sulfur cluster biogenesis with the CIAO1-mediated transfer to recipients.; Authors - Ki Soon Kim

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Ana Paula (Verified Customer) (08-03-2022)

mESC derived motor neurons 1:1000 primary ab in blocking buffer ON at 4 C 1:10000 secondary ab in TBS 1h at RT

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: mESC derived motor neurons

URM1 Antibody Western Blot validation (1:1000 dilution) in mESC derived motor neurons (Cat no:15285-1-AP)