Recombinant human USP2 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag0591
Synonyms
USP2, Deubiquitinating enzyme 2, EC:3.4.19.12, ubiquitin specific peptidase 2, Ubiquitin thiolesterase 2
Validation Data Gallery View All
Product Information
| Peptide Sequence |
YTESARYTDAHYAKSGYGAYTPSSYGANLAASLLEKEKLGFKPVPTSSFLTRPRTYGPSSLLDYDRGRPLLRPDITGGGKRAESQTRGTERPLGSGLSGGSGFPYGVTNNCLSYLPINAYDQGVTLTQKLDSQSDLARDFSSLRTSDSYRIDPRNLGRSPMLARTRKELCTLQGLYQTASCPEYLVDYLENYGRKGSASQVPSQAPPSRVPEIISPTYRPIGRYTLWETGK
(11-241 aa encoded by BC002955) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
