CoraLite®594-conjugated USP4 Monoclonal antibody

USP4 Monoclonal Antibody for
Cat No. CL594-66822
Clone No.1G11G8

Host / Isotype

Mouse / IgG2b

Reactivity

Human, Mouse

Applications

Unph, UNP, Ubiquitin-specific-processing protease 4, Ubiquitin carboxyl-terminal hydrolase 4, EC:3.4.19.12

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

CL594-66822 targets USP4 in applications and shows reactivity with Human, Mouse samples.

Tested Reactivity Human, Mouse
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28297

Product name: Recombinant human USP4 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 567-779 aa of BC125131

Sequence: VCSTSVDGSECVTLPVYFRERKSRPSSTSSASALYGQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPLPDEFGSSPLEPGACNGSRNSCEGEDEEEMEHQEEGKEQLSETEGSGEDEPGNDPSETTQKKIKGQPCPKRLFTFSLVNSYGTADINSLAADGKLLKLNSRSTLAMDWDSETRRLYYDEQESEAYEKHVSMLQPQKKKKTTVALR

Predict reactive species
Full Name ubiquitin specific peptidase 4 (proto-oncogene)
Calculated Molecular Weight 963 aa, 109 kDa
Observed Molecular Weight 109 kDa
GenBank Accession NumberBC125131
Gene Symbol USP4
Gene ID (NCBI) 7375
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13107
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

USP4, also named as UNP and UNPH, belongs to the peptidase C19 family and USP4 subfamily. USP4 is a deubiquitinating enzyme that links to mitogen-activated protein kinase signaling, pre-mRNA splicing, and control of p53 stability (PMID: 26455393). USP4 has 3 isoforms with the molecular mass of 36, 104 and 109 kDa. Recently, it has been reported that USP4 is a critical factor in promoting lung cancer stemness and potentially useful lung cancer prognosis marker (PMID: 32549341).

Loading...
||
New chat

Able

正在加载,请稍候...