USP4 Monoclonal antibody

USP4 Monoclonal Antibody for WB, IHC, IF-P, FC (Intra), ELISA
Cat No. 66822-1-Ig
Clone No.1G11G8

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse

Applications

WB, IHC, IF-P, FC (Intra), IP, ELISA

1G11G8, EC:3.4.19.12, Ubiquitin carboxyl-terminal hydrolase 4, Ubiquitin-specific-processing protease 4, UNP

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, Jurkat cells, HEK-293 cells, THP-1 cells, NCI-H1299 cells, RAW 264.7 cells
Positive IHC detected inhuman breast cancer tissue, mouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman breast cancer tissue, human liver cancer tissue
Positive FC (Intra) detected inTHP-1 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:100-1:300
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66822-1-Ig targets USP4 in WB, IHC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28297

Product name: Recombinant human USP4 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 567-779 aa of BC125131

Sequence: VCSTSVDGSECVTLPVYFRERKSRPSSTSSASALYGQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPLPDEFGSSPLEPGACNGSRNSCEGEDEEEMEHQEEGKEQLSETEGSGEDEPGNDPSETTQKKIKGQPCPKRLFTFSLVNSYGTADINSLAADGKLLKLNSRSTLAMDWDSETRRLYYDEQESEAYEKHVSMLQPQKKKKTTVALR

Predict reactive species
Full Name ubiquitin specific peptidase 4 (proto-oncogene)
Calculated Molecular Weight 963 aa, 109 kDa
Observed Molecular Weight 109 kDa
GenBank Accession NumberBC125131
Gene Symbol USP4
Gene ID (NCBI) 7375
RRIDAB_2882165
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13107
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

USP4, also named as UNP and UNPH, belongs to the peptidase C19 family and USP4 subfamily. USP4 is a deubiquitinating enzyme that links to mitogen-activated protein kinase signaling, pre-mRNA splicing, and control of p53 stability (PMID: 26455393). USP4 has 3 isoforms with the molecular mass of 36, 104 and 109 kDa. Recently, it has been reported that USP4 is a critical factor in promoting lung cancer stemness and potentially useful lung cancer prognosis marker (PMID: 32549341).

Protocols

Product Specific Protocols
FC protocol for USP4 antibody 66822-1-IgDownload protocol
IF protocol for USP4 antibody 66822-1-IgDownload protocol
IHC protocol for USP4 antibody 66822-1-IgDownload protocol
WB protocol for USP4 antibody 66822-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

Cell Death Dis

USP4 promotes the proliferation, migration, and invasion of esophageal squamous cell carcinoma by targeting TAK1

Authors - Hongdian Zhang
humanWB

Phytomedicine

Vialinin A alleviates oxidative stress and neuronal injuries after ischaemic stroke by accelerating Keap1 degradation through inhibiting USP4-mediated deubiquitination

Authors - Meng Mao
mouseWB

bioRxiv

The DNA helicase FANCJ (BRIP1) functions in Double Strand Break repair processing, but not crossover formation during Prophase I of meiosis in male mice

Authors - Tegan S Horan
humanWB,IP,IF

Autophagy

USP4 depletion-driven RAB7A ubiquitylation impairs autophagosome-lysosome fusion and aggravates periodontitis

Authors - Sen Kang
humanWB,IP,IF

PLoS One

USP4 promotes the proliferation and glucose metabolism of gastric cancer cells by upregulating PKM2

Authors - Yuanyuan Chen

Cell Death Dis

USP4-mediated CENPF deubiquitylation regulated tumor metastasis in colorectal cancer

Authors - Zhongdong Xie
Loading...
||
New chat Able
正在加载,请稍候...