USP7 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• USP7 Polyclonal antibody (26948-1-AP)

• Featured Product
• KD/KO Validated

USP7 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26948-1-AP Copied!

Publications (18)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, RIP, ELISA

Synonyms

Deubiquitinating enzyme 7, HAUSP, TEF1, Ubiquitin thioesterase 7, USP7

• 

  WB analysis using 26948-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26948-1-AP (USP7 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of U2OS using 26948-1-AP

  U2OS cells were subjected to SDS PAGE followed by western blot with 26948-1-AP (USP7 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 26948-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 26948-1-AP (USP7 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse spleen using 26948-1-AP

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 26948-1-AP (USP7 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of U2OS using 26948-1-AP

  U2OS cells were subjected to SDS PAGE followed by western blot with 26948-1-AP (USP7 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 26948-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26948-1-AP (USP7 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 26948-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 26948-1-AP (USP7 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 26948-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 26948-1-AP (USP7 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for USP7 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: MCF-7 cells, U2OS cells, K-562 cells, mouse spleen tissue, NIH/3T3 cells, PC-12 cells
• Positive IHC detected in: human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26948-1-AP targets USP7 in WB, IHC, IF, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25634

  Product name: Recombinant human USP7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-93 aa of

  Sequence: MLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKNIFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVK

• Full Name: ubiquitin specific peptidase 7 (herpes virus-associated)
• Observed Molecular Weight: 126-128 kDa
• Gene Symbol: USP7
• Gene ID (NCBI): 7874
• RRID: AB_2880696
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q93009
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

USP7 antibody (Cat# 26948-1-AP) has 18 total citations published in journals including Cancer Research, Cell Death & Disease, PNAS, International Journal of Biological Sciences, British Journal of Cancer, Frontiers in Immunology, Journal of Neuroimmune Pharmacology, European Journal of Pharmacology, Molecular Neurobiology, Frontiers in Pharmacology, Translational Oncology, Cell Signaling, ACS Pharmacology & Translational Science, FEBS Letters, Discovery Oncology, Virology, and International Journal of Biological Macromolecules. Research fields span oncology, immunology, neuroscience, cardiology, epigenetics, and virology.

Automatically generated from the 18 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Cancer Res; Targeting USP7 identifies a metastasis-competent state within bone marrow-resident melanoma CTCs.; Authors - Monika Vishnoi
		Cell Death Dis; USP7 promotes temozolomide resistance by stabilizing MGMT in glioblastoma; Authors - Jiabing Li
human	WB,IHC	Int J Biol Sci; Flap endonuclease 1 Facilitated Hepatocellular Carcinoma Progression by Enhancing USP7/MDM2-mediated P53 Inactivation.; Authors - Saiyan Bian
human	WB,IHC	Proc Natl Acad Sci U S A; High-throughput screening identifies a critical role of the SPOP-PABPC1 axis in lung adenocarcinoma progression.; Authors - Jiahui Zhang
		Int J Biol Macromol; The USP7-VIM axis mediates lipid metabolic remodelling and compromises CD8(+) T-cell mitochondrial fitness in glioblastoma.; Authors - Liyan Tang
human	WB,IHC	Br J Cancer; Suppression of LRRC41-mediated oncogenicity in hepatocellular carcinoma via USP7-targeted small molecule inhibitors.; Authors - Yue Huang ; KD Validated