Tested Applications
Positive WB detected in | MCF-7 cells, U2OS cells, K-562 cells, mouse spleen tissue, NIH/3T3 cells, PC-12 cells |
Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:3000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 8 publications below |
IHC | See 3 publications below |
RIP | See 1 publications below |
Product Information
26948-1-AP targets USP7 in WB, IHC, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25634 Product name: Recombinant human USP7 protein Source: e coli.-derived, PGEX-4T Tag: GST Sequence: MLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKNIFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVK Predict reactive species |
Full Name | ubiquitin specific peptidase 7 (herpes virus-associated) |
Observed Molecular Weight | 126-128 kDa |
Gene Symbol | USP7 |
Gene ID (NCBI) | 7874 |
RRID | AB_2880696 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q93009 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for USP7 antibody 26948-1-AP | Download protocol |
IHC protocol for USP7 antibody 26948-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cancer Res Targeting USP7 identifies a metastasis-competent state within bone marrow-resident melanoma CTCs. | ||
Front Immunol Specific Deubiquitinating Enzymes Promote Host Restriction Factors Against HIV/SIV Viruses.
| ||
Int J Biol Sci Flap endonuclease 1 Facilitated Hepatocellular Carcinoma Progression by Enhancing USP7/MDM2-mediated P53 Inactivation. | ||
Discov Oncol High dose isoleucine stabilizes nuclear PTEN to suppress the proliferation of lung cancer | ||
Front Pharmacol Administration of USP7 inhibitor P22077 inhibited cardiac hypertrophy and remodeling in Ang II-induced hypertensive mice | ||
ACS Pharmacol Transl Sci Bruceine B Displays Potent Antimyeloma Activity by Inducing the Degradation of the Transcription Factor c-Maf |