USP7 Polyclonal antibody

• 

  WB analysis using 26948-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26948-1-AP (USP7 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 26948-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26948-1-AP (USP7 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse spleen using 26948-1-AP

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 26948-1-AP (USP7 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of U2OS using 26948-1-AP

  U2OS cells were subjected to SDS PAGE followed by western blot with 26948-1-AP (USP7 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 26948-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 26948-1-AP (USP7 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of U2OS using 26948-1-AP

  U2OS cells were subjected to SDS PAGE followed by western blot with 26948-1-AP (USP7 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human prostate cancer using 26948-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 26948-1-AP (USP7 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 26948-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 26948-1-AP (USP7 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

USP7 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26948-1-AP

Publications(9)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, RIP, ELISA

Synonyms

Deubiquitinating enzyme 7, HAUSP, TEF1, Ubiquitin thioesterase 7, USP7

---

Tested Applications

• Positive WB detected in: MCF-7 cells, U2OS cells, K-562 cells, mouse spleen tissue, NIH/3T3 cells, PC-12 cells
• Positive IHC detected in: human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 8 publications below
• IHC: See 3 publications below
• RIP: See 1 publications below

Product Information

26948-1-AP targets USP7 in WB, IHC, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25634

  Product name: Recombinant human USP7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-93 aa of

  Sequence: MLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKNIFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVK

• Full Name: ubiquitin specific peptidase 7 (herpes virus-associated)
• Observed Molecular Weight: 126-128 kDa
• Gene Symbol: USP7
• Gene ID (NCBI): 7874
• RRID: AB_2880696
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q93009
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Cancer Res; Targeting USP7 identifies a metastasis-competent state within bone marrow-resident melanoma CTCs.; Authors - Monika Vishnoi
human	WB	Front Immunol; Specific Deubiquitinating Enzymes Promote Host Restriction Factors Against HIV/SIV Viruses.; Authors - Wenying Gao ; KD Validated
human	WB,IHC	Int J Biol Sci; Flap endonuclease 1 Facilitated Hepatocellular Carcinoma Progression by Enhancing USP7/MDM2-mediated P53 Inactivation.; Authors - Saiyan Bian
human	WB	Discov Oncol; High dose isoleucine stabilizes nuclear PTEN to suppress the proliferation of lung cancer; Authors - Haiqing Wang
mouse	WB,IHC	Front Pharmacol; Administration of USP7 inhibitor P22077 inhibited cardiac hypertrophy and remodeling in Ang II-induced hypertensive mice; Authors - Yu-Hui Gu
human	WB,RIP	Transl Oncol; PiR-hsa-23533 promotes malignancy in head and neck squamous cell carcinoma via USP7; Authors - Hanlin Hu