Product Information
26948-1-PBS targets USP7 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25634 Product name: Recombinant human USP7 protein Source: e coli.-derived, PGEX-4T Tag: GST Sequence: MLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKNIFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVK Predict reactive species |
| Full Name | ubiquitin specific peptidase 7 (herpes virus-associated) |
| Observed Molecular Weight | 126-128 kDa |
| Gene Symbol | USP7 |
| Gene ID (NCBI) | 7874 |
| RRID | AB_2880696 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q93009 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |















