UTP6 Polyclonal antibody, PBS Only

• 

  WB analysis of HeLa using 17671-1-AP (same clone as 17671-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 17671-1-AP (UTP6 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17671-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 17671-1-AP (same clone as 17671-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 17671-1-AP (UTP6 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17671-1-PBS in a different storage buffer formulation.

UTP6 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 17671-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

17671-1-PBS targets UTP6 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11327

  Product name: Recombinant human UTP6 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-335 aa of BC035325

  Sequence: MAEIIQERIEDRLPELEQLERIGLFSHAEIKAIIKKASDLEYKIQRRTLFKEDFINYVQYEINLLELIRRRRTRIGYSFKKDEIENSIVHRVQGVFQRASAKWKDDVQLWLSYVAFCKKWATKTRLSKVFSAMLAIHSNKPALWIMAAKWEMEDRLSSESARQLFLRALRFHPECPKLYKEYFRMELMHAEKLRKEKEEFEKASMDVENPDYSEEILKGELAWIIYKNSVSIIKGAEFHVSLLSIAQLFDFAKDLQKEIYDDLQALHTDDPLTWDYVARRELEIESQTEEQPTTKQAKAVEVGRKEERCCAVYEEAVKTLPTEAMWKCYITFCLE

• Full Name: UTP6, small subunit (SSU) processome component, homolog (yeast)
• Calculated Molecular Weight: 597 aa, 70 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC035325
• Gene Symbol: UTP6
• Gene ID (NCBI): 55813
• RRID: AB_2214465
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NYH9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.