UTP6 Polyclonal antibody

• 

  WB analysis of HeLa using 17671-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 17671-1-AP (UTP6 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 17671-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 17671-1-AP (UTP6 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

UTP6 Polyclonal Antibody for WB, ELISA

Cat No. 17671-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

C17orf40, HCA66, MHAT, Multiple hat domains protein, UTP6

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

17671-1-AP targets UTP6 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11327

  Product name: Recombinant human UTP6 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-335 aa of BC035325

  Sequence: MAEIIQERIEDRLPELEQLERIGLFSHAEIKAIIKKASDLEYKIQRRTLFKEDFINYVQYEINLLELIRRRRTRIGYSFKKDEIENSIVHRVQGVFQRASAKWKDDVQLWLSYVAFCKKWATKTRLSKVFSAMLAIHSNKPALWIMAAKWEMEDRLSSESARQLFLRALRFHPECPKLYKEYFRMELMHAEKLRKEKEEFEKASMDVENPDYSEEILKGELAWIIYKNSVSIIKGAEFHVSLLSIAQLFDFAKDLQKEIYDDLQALHTDDPLTWDYVARRELEIESQTEEQPTTKQAKAVEVGRKEERCCAVYEEAVKTLPTEAMWKCYITFCLE

• Full Name: UTP6, small subunit (SSU) processome component, homolog (yeast)
• Calculated Molecular Weight: 597 aa, 70 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC035325
• Gene Symbol: UTP6
• Gene ID (NCBI): 55813
• RRID: AB_2214465
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NYH9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Rep; Patient-derived iPSC-cerebral organoid modeling of the 17q11.2 microdeletion syndrome establishes CRLF3 as a critical regulator of neurogenesis.; Authors - Michelle L Wegscheid