UTY Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84332-5-RR (same clone as 84332-5-PBS)

  THP-1 cells were subjected to SDS PAGE followed by western blot with 84332-5-RR (UTY antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84332-5-PBS in a different storage buffer formulation.

• 

  IF Staining of MDA-MB-231 using 84332-5-RR (same clone as 84332-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MDA-MB-231 cells using UTY antibody (84332-5-RR, Clone: 241626F7 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 84332-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84332-5-RR

  Biolayer interferometry (BLl) kinetic assays of 84332-5-RR against Human UTY were performed. The affinity constant is 0.23 nM.

UTY Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 84332-5-PBS

Clone No.241626F7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

UTY1, KDM6C, KDM6AL, Histone demethylase UTY, 241626F7

---

Product Information

84332-5-PBS targets UTY in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag35806

  Product name: Recombinant human UTY protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 560-655 aa of NM_007125.4

  Sequence: QQNTHTLPHNHTDLNSSTEEPWRKQLSNSAQGLHKSQSSCLSGPNEEQPLFSTGSAQYHQATSTGIKKANEHLTLPSNSVPQGDADSHLSCHTATS

• Full Name: ubiquitously transcribed tetratricopeptide repeat gene, Y-linked
• Calculated Molecular Weight: 150kDa，1347aa
• Observed Molecular Weight: 130-160kDa
• GenBank Accession Number: NM_007125.4
• Gene Symbol: UTY
• Gene ID (NCBI): 7404
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O14607
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

UTY (Ubiquitously Transcribed Tetratricopeptide Repeat Containing, Y-Linked) is a protein-coding gene located on the Y chromosome. It is the Y-linked homolog of the X-linked gene KDM6A, which encodes a histone demethylase. UTY is involved in the regulation of gene expression and chromatin structure, similar to its X-linked counterpart KDM6A (PMID: 31097364). UTY is expressed in various tissues and is predicted to be involved in transcription, translation, and nucleic acid binding, which are central to the regulation of gene expression during development, immune function, cell proliferation, and differentiation.