Product Information
84332-5-PBS targets UTY in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag35806 Product name: Recombinant human UTY protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 560-655 aa of NM_007125.4 Sequence: QQNTHTLPHNHTDLNSSTEEPWRKQLSNSAQGLHKSQSSCLSGPNEEQPLFSTGSAQYHQATSTGIKKANEHLTLPSNSVPQGDADSHLSCHTATS Predict reactive species |
| Full Name | ubiquitously transcribed tetratricopeptide repeat gene, Y-linked |
| Calculated Molecular Weight | 150kDa,1347aa |
| Observed Molecular Weight | 130-160kDa |
| GenBank Accession Number | NM_007125.4 |
| Gene Symbol | UTY |
| Gene ID (NCBI) | 7404 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | O14607 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
UTY (Ubiquitously Transcribed Tetratricopeptide Repeat Containing, Y-Linked) is a protein-coding gene located on the Y chromosome. It is the Y-linked homolog of the X-linked gene KDM6A, which encodes a histone demethylase. UTY is involved in the regulation of gene expression and chromatin structure, similar to its X-linked counterpart KDM6A (PMID: 31097364). UTY is expressed in various tissues and is predicted to be involved in transcription, translation, and nucleic acid binding, which are central to the regulation of gene expression during development, immune function, cell proliferation, and differentiation.





