VANGL2 Polyclonal antibody

• 

  WB analysis using 21492-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21492-1-AP (VANGL2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 21492-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21492-1-AP (VANGL2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HepG2 using 21492-1-AP

  IP result of anti-VANGL2 (IP:21492-1-AP, 4ug; Detection:21492-1-AP 1:500) with HepG2 cells lysate 1880 ug.

• 

  IHC staining of human stomach using 21492-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 21492-1-AP (VANGL2 antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human stomach using 21492-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 21492-1-AP (VANGL2 antibody) at dilution of 1:200 (under 40x lens).

• 

  IF Staining of HepG2 using 21492-1-AP

  Immunofluorescent analysis of HepG2 cells using 21492-1-AP (VANGL2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

VANGL2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 21492-1-AP

Publications(15)

Reviews (3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

STB1, LTAP, LPP1, Loop-tail protein 1 homolog, Loop tail protein 1 homolog

---

Tested Applications

• Positive WB detected in: HepG2 cells, mouse brain tissue, NIH/3T3 cells, rat brain tissue
• Positive IP detected in: HepG2 cells
• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 10 publications below
• IF: See 7 publications below
• IP: See 1 publications below
• CoIP: See 1 publications below

Product Information

21492-1-AP targets VANGL2 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15833

  Product name: Recombinant human VANGL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 268-322 aa of BC103920

  Sequence: IQRVAVWILEKYYHDFPVYNPALLNLPKSVLAKKVSGFKVYSLGEENSTNNSTGQ

• Full Name: vang-like 2 (van gogh, Drosophila)
• Calculated Molecular Weight: 521 aa, 60 kDa
• Observed Molecular Weight: 60-70 kDa
• GenBank Accession Number: BC103920
• Gene Symbol: VANGL2
• Gene ID (NCBI): 57216
• RRID: AB_11182263
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9ULK5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Vangl2 is a key component of the planar cell polarity (PCP) pathway. Vangl2 is tightly associated with the postsynaptic density (PSD) fraction and forms a protein complex with PSD-95 and NMDA receptors. Vangl2 directly binds to the third PDZ domain of PSD-95 via its C-terminal TSV motif. Vangl2 directly binds to N-cadherin.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Adv Sci (Weinh); Isolation and Comprehensive Analysis of Cochlear Tissue-Derived Small Extracellular Vesicles; Authors - Pei Jiang
mouse	IF,WB	Dev Cell; Vangl2 limits chaperone-mediated autophagy to balance osteogenic differentiation in mesenchymal stem cells.; Authors - Yan Gong ; KD Validated
human	WB,IF	Cancer Lett; A complex of Wnt/planar cell polarity signaling components Vangl1 and Fzd7 drives glioblastoma multiforme malignant properties; Authors - Courtney A Dreyer
	IF	Sci Signal; The Helicobacter pylori CagA oncoprotein disrupts Wnt/PCP signaling and promotes hyperproliferation of pyloric gland base cells; Authors - Atsushi Takahashi-Kanemitsu
human	CoIP	Exp Cell Res; VANGL2 interacts with integrin αv to regulate matrix metalloproteinase activity and cell adhesion to the extracellular matrix.; Authors - Tammy N Jessen
	WB	FASEB J; Folate regulation of planar cell polarity pathway and F-actin through folate receptor alpha; Authors - Xiao Han

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Nin (Verified Customer) (11-07-2024)

A good antibody to detect endogenous VANGL although there are nonspecific bands.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: mouse brain lysate

VANGL2 Antibody Western Blot validation (1:1000 dilution) in mouse brain lysate (Cat no:21492-1-AP)

FH

Stephen (Verified Customer) (05-31-2023)

works in chicken tissue fixed with 4% PFA for 2 hours, perm 0.3% tx100 for 2h primary incubated 1:200 for 24h @4 degrees,

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:200
• Cell Tissue Type: chicken - embryonic auditory epithelia

VANGL2 Antibody Immunofluorescence validation (1:200 dilution) in chicken - embryonic auditory epithelia (Cat no:21492-1-AP)

FH

Louisiane (Verified Customer) (08-11-2022)

Tissues (small intestine sections) were incubated with primary antibody over the weekend at 4C and with secondary antibody overnight at 4C. The signal looks good but there is a bit of background

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1 to 100