VAPA Polyclonal antibody, PBS Only

• 

  WB analysis using 15275-1-AP (same clone as 15275-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 15275-1-AP (VAPA antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15275-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 15275-1-AP (same clone as 15275-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15275-1-AP (VAPA antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15275-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skeletal muscle using 15275-1-AP (same clone as 15275-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 15275-1-AP (VAPA antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15275-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human kidney using 15275-1-AP (same clone as 15275-1-PBS)

  human kidney tissue were subjected to SDS PAGE followed by western blot with 15275-1-AP (VAPA antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15275-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 15275-1-AP (same clone as 15275-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 15275-1-AP (VAPA antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15275-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 15275-1-AP (same clone as 15275-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15275-1-AP (VAPA antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15275-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 15275-1-AP (same clone as 15275-1-PBS)

  IP result of anti-VAPA (IP:15275-1-AP, 3ug; Detection:15275-1-AP 1:1000) with HEK-293 cells lysate 3200ug. This data was developed using the same antibody clone with 15275-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 15275-1-AP (same clone as 15275-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 15275-1-AP (VAPA antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15275-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 15275-1-AP (same clone as 15275-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 15275-1-AP (VAPA antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15275-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 15275-1-AP (same clone as 15275-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15275-1-AP (VAPA antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15275-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 15275-1-AP (same clone as 15275-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15275-1-AP (VAPA antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15275-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 15275-1-AP (same clone as 15275-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15275-1-AP (VAPA antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15275-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 15275-1-AP (same clone as 15275-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 15275-1-AP (VAPA antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15275-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 15275-1-AP (same clone as 15275-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 15275-1-AP (VAPA antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15275-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 15275-1-AP (same clone as 15275-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using VAPA antibody (15275-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 15275-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 15275-1-AP (same clone as 15275-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using VAPA antibody (15275-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red). This data was developed using the same antibody clone with 15275-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 15275-1-AP (same clone as 15275-1-PBS)

  Immunofluorescent analysis of HEK-293 cells using 15275-1-AP (VAPA antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 15275-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

VAPA Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 15275-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

33 kDa VAMP associated protein, 33 kDa VAMP-associated protein, hVAP 33, VAMP A, VAMP associated protein A

---

Product Information

15275-1-PBS targets VAPA in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7393

  Product name: Recombinant human VAPA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-221 aa of BC002992

  Sequence: MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFR

• Full Name: VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 28-30 kDa
• GenBank Accession Number: BC002992
• Gene Symbol: VAPA
• Gene ID (NCBI): 9218
• RRID: AB_2256991
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P0L0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

VAPA (Vesicle-associated membrane protein-associated protein A), also known as VAP33, is a ubiquitously expressed integral membrane protein of the VAMP-associated protein (VAP) family. It is present in the plasma membrane and in intracellular vesicles, playing a role in vesicle trafficking.