Filter: AllWBIPIHC

WB analysis using 16364-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 16364-1-AP (VAV1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.
WB analysis using 16364-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 16364-1-AP (VAV1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.
WB analysis of HL-60 using 16364-1-AP
HL-60 cells were subjected to SDS PAGE followed by western blot with 16364-1-AP (VAV1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
IP experiment of K-562 using 16364-1-AP
IP result of anti-VAV1 (IP:16364-1-AP, 4ug; Detection:16364-1-AP 1:4000) with K-562 cells lysate 1800 ug.
IHC staining of human breast cancer using 16364-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 16364-1-AP (VAV1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human breast cancer using 16364-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 16364-1-AP (VAV1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human tonsillitis using 16364-1-AP
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 16364-1-AP (VAV1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human heart using 16364-1-AP
Immunohistochemical analysis of paraffin-embedded human heart using 16364-1-AP (VAV1 antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human heart using 16364-1-AP
Immunohistochemical analysis of paraffin-embedded human heart using 16364-1-AP (VAV1 antibody) at dilution of 1:50 (under 40x lens).
IHC staining of human kidney using 16364-1-AP
Immunohistochemical analysis of paraffin-embedded human kidney using 16364-1-AP (VAV1 antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human kidney using 16364-1-AP
Immunohistochemical analysis of paraffin-embedded human kidney using 16364-1-AP (VAV1 antibody) at dilution of 1:50 (under 40x lens).
IHC staining of human brain using 16364-1-AP
Immunohistochemical analysis of paraffin-embedded human brain using 16364-1-AP (VAV1 antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human brain using 16364-1-AP
Immunohistochemical analysis of paraffin-embedded human brain using 16364-1-AP (VAV1 antibody) at dilution of 1:50 (under 40x lens).
IHC staining of human liver using 16364-1-AP
Immunohistochemical analysis of paraffin-embedded human liver using 16364-1-AP (VAV1 antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human liver using 16364-1-AP
Immunohistochemical analysis of paraffin-embedded human liver using 16364-1-AP (VAV1 antibody) at dilution of 1:50 (under 40x lens).
IHC staining of human spleen using 16364-1-AP
Immunohistochemical analysis of paraffin-embedded human spleen using 16364-1-AP (VAV1 antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human spleen using 16364-1-AP
Immunohistochemical analysis of paraffin-embedded human spleen using 16364-1-AP (VAV1 antibody) at dilution of 1:50 (under 40x lens).
IHC staining of human lung using 16364-1-AP
Immunohistochemical analysis of paraffin-embedded human lung using 16364-1-AP (VAV1 antibody) at dilution of 1:50 (under 40x lens).
IHC staining of human lung using 16364-1-AP
Immunohistochemical analysis of paraffin-embedded human lung using 16364-1-AP (VAV1 antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human lymphoma using 16364-1-AP
Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 16364-1-AP (VAV1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human lymphoma using 16364-1-AP
Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 16364-1-AP (VAV1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Featured Product
KD/KO Validated

VAV1 Polyclonal antibody

VAV1 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 16364-1-AP

Publications(8)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human and More (3)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

Proto oncogene vav, Proto-oncogene vav, VAV

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Publications (8)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	Jurkat cells, HL-60 cells, Ramos cells, K-562 cells, Raji cells
Positive IP detected in	K-562 cells
Positive IHC detected in	human breast cancer tissue, human brain tissue, human heart tissue, human kidney tissue, human liver tissue, human lung tissue, human lymphoma tissue, human spleen tissue, human tonsillitis tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:8000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

KD/KO	See 2 publications below
WB	See 7 publications below
IHC	See 1 publications below
IF	See 3 publications below

Product Information

16364-1-AP targets VAV1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Cited Reactivity	human, mouse, rat, gecko
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag9049 Product name: Recombinant human VAV1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 442-790 aa of BC013361 Sequence: EQFEMAISNIYPENATANGHDFQMFSFEETTSCKACQMLLRGTFYQGYRCHRCRASAHKECLGRVPPCGRHGQDFPGTMKKDKLHRRAQDKKRNELGLPKMEVFQEYYGLPPPPGAIGPFLRLNPGDIVELTKAEAEQNWWEGRNTSTNEIGWFPCNRVKPYVHGPPQDLSVHLWYAGPMERAGAESILANRSDGTFLVRQRVKDAAEFAISIKYNVEVKHIKIMTAEGLYRITEKKAFRGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISRPAVGSTKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEEDYSEYC Predict reactive species
Full Name	vav 1 guanine nucleotide exchange factor
Calculated Molecular Weight	845 aa, 98 kDa
Observed Molecular Weight	98 kDa
GenBank Accession Number	BC013361
Gene Symbol	VAV1
Gene ID (NCBI)	7409
RRID	AB_2213571
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P15498
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Vav proteins mainly act as enzymes that catalyze the activation step of Rho subfamily GTPases during cell signaling. There are three family members:VAV1, VAV2 and VAV3. Vav1 is specifically expressed in the hematopoietic system, whereas Vav2 and Vav3 are more ubiquitously expressed (PMID:14607270). Vav1 is physiologically active as a GDP/GTP nucleotide exchange factor (GEF) in the hematopoietic system (PMID:31654719).

Protocols

Product Specific Protocols
IHC protocol for VAV1 antibody 16364-1-AP	Download protocol
IP protocol for VAV1 antibody 16364-1-AP	Download protocol
WB protocol for VAV1 antibody 16364-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

Species	Application	Title
gecko	WB,IF	J Biol Chem Adult astrocytes from reptiles are resistant to proinflammatory activation via sustaining Vav1 expression. Authors - Nan Du KD Validated View Article
human	WB,IHC	Biochem Biophys Res Commun Vav1 expression is increased in esophageal squamous cell carcinoma and indicates poor prognosis. Authors - Xiaolei Zhu View Article
human	WB	Oncotarget Multiple regulatory aspects of histone methyltransferase EZH2 in Pb-induced neurotoxicity. Authors - Wei-Zhen Xue View Article
rat	WB,IF	Clin Sci (Lond) Novel role of Vav1-Rac1 pathway in actin cytoskeleton regulation in Interleukin-13-induced minimal change-like nephropathy. Authors - Chang-Yien Chan KD Validated View Article
human	WB	Cancer Cell Int STING pathway contributes to the prognosis of hepatocellular carcinoma and identification of prognostic gene signatures correlated to tumor microenvironment Authors - Zhangya Pu View Article
rat	IF	Neural Regen Res Vav1 promotes inflammation and neuronal apoptosis in cerebral ischemia/reperfusion injury by upregulating microglial and NLRP3 inflammasome activation Authors - Jing Qiu View Article