Use Able AI chat for product recommendations

VDR Monoclonal antibody

VDR Monoclonal Antibody for ELISA

Cat No. 60116-2-Ig
Clone No.4C2F1

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

ELISA

Formulation:  PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60116-2-Ig targets VDR in ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6012

Product name: Recombinant human VDR protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 128-427 aa of BC060832

Sequence: QQRIIAILLDAHHKTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSGDSSSSCSDHCITSSDMMDSSSFSNLDLSEEDSDDPSVTLELSQLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRSNESFTMDDMSWTCGNQDYKYRVSDVTKAGHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAALIEAIQDRLSNTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLEVFGNEIS

Predict reactive species
Full Name vitamin D (1,25- dihydroxyvitamin D3) receptor
Calculated Molecular Weight 48 kDa
Observed Molecular Weight 55 kDa
GenBank Accession NumberBC060832
Gene Symbol VDR
Gene ID (NCBI) 7421
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP11473
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The vitamin D receptor (VDR), also known as NR1I1 (nuclear receptor subfamily 1, group I, member 1), is a member of the nuclear receptor family of transcription factors. Upon activation by vitamin D, the VDR forms a heterodimer with the retinoid-X receptor and binds to hormone response elements on DNA resulting in expression or trans-repression of specific gene products.It is an intracellular hormone receptor that specifically binds 1,25(OH)2D3 and mediates its effects. Downstream targets of this nuclear hormone receptor are principally involved in mineral metabolism though the receptor regulates a variety of other metabolic pathways, such as those involved in the immune response and cancer. Defects in VDR are the cause of rickets vitamin D-dependent type 2A (VDDR2A). A disorder of vitamin D metabolism results in severe rickets, hypocalcemia and secondary hyperparathyroidism. Most patients have total alopecia in addition to rickets. This antibody is a mouse monoclonal IgG2a antibody to human VDR.

Loading...
||
New chat

Able

正在加载,请稍候...