VDR Recombinant monoclonal antibody

VDR Uni-rAb® Recombinant Antibody for WB, IP, ELISA
Cat No. 87335-1-RR
Clone No.252576C4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, ELISA

NR1I1, Vitamin D3 receptor

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, T-47D cells, MCF-7 cells
Positive IP detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:10000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

87335-1-RR targets VDR in WB, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag28176

Product name: Recombinant human VDR protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 81-220 aa of BC060832

Sequence: LKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSGDSSSSCSDHCITSSDMMDSSSFSNLDLSEEDSDDPSVTLE

Predict reactive species
Full Name vitamin D (1,25- dihydroxyvitamin D3) receptor
Calculated Molecular Weight 48 kDa
Observed Molecular Weight48 kDa
GenBank Accession NumberBC060832
Gene Symbol VDR
Gene ID (NCBI) 7421
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP11473
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The vitamin D3 receptor (VDR), also known as NR1I1 (nuclear receptor subfamily 1, group I, member 1), is a member of the nuclear receptor family of transcription factors. Upon activation by vitamin D, the VDR forms a heterodimer with the retinoid-X receptor and binds to hormone response elements on DNA resulting in expression or trans-repression of specific gene products.It is an intracellular hormone receptor that specifically binds 1,25(OH)2D3 and mediates its effects. Downstream targets of this nuclear hormone receptor are principally involved in mineral metabolism though the receptor regulates a variety of other metabolic pathways, such as those involved in the immune response and cancer. Defects in VDR are the cause of rickets vitamin D-dependent type 2A (VDDR2A). A disorder of vitamin D metabolism results in severe rickets, hypocalcemia and secondary hyperparathyroidism. Most patients have total alopecia in addition to rickets. The VDR exists two isoform with the MV 48 kDa and 54 kDa.

Protocols

Product Specific Protocols
IP protocol for VDR antibody 87335-1-RRDownload protocol
WB protocol for VDR antibody 87335-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...