VDR Recombinant monoclonal antibody

• 

  WB analysis using 87335-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87335-1-RR (VDR antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 87335-1-RR

  T-47D cell lysates were subjected to SDS PAGE followed by western blot with 87335-1-RR (VDR antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 87335-1-RR

  IP result of anti-VDR (IP:87335-1-RR, 4ug; Detection:87335-1-RR 1:1500) with HeLa cells lysate 1320 ug.

• 

  Affinity of 87335-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87335-1-RR against Human VDR were performed. The affinity constant is 2.01 nM.

VDR Uni-rAb^® Recombinant Antibody for WB, IP, ELISA

Cat No. 87335-1-RR

Clone No.252576C4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, ELISA

Synonyms

NR1I1, Vitamin D3 receptor

---

Tested Applications

• Positive WB detected in: HeLa cells, T-47D cells, MCF-7 cells
• Positive IP detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87335-1-RR targets VDR in WB, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag28176

  Product name: Recombinant human VDR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 81-220 aa of BC060832

  Sequence: LKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSGDSSSSCSDHCITSSDMMDSSSFSNLDLSEEDSDDPSVTLE

• Full Name: vitamin D (1,25- dihydroxyvitamin D3) receptor
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC060832
• Gene Symbol: VDR
• Gene ID (NCBI): 7421
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P11473
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The vitamin D3 receptor (VDR), also known as NR1I1 (nuclear receptor subfamily 1, group I, member 1), is a member of the nuclear receptor family of transcription factors. Upon activation by vitamin D, the VDR forms a heterodimer with the retinoid-X receptor and binds to hormone response elements on DNA resulting in expression or trans-repression of specific gene products.It is an intracellular hormone receptor that specifically binds 1,25(OH)2D3 and mediates its effects. Downstream targets of this nuclear hormone receptor are principally involved in mineral metabolism though the receptor regulates a variety of other metabolic pathways, such as those involved in the immune response and cancer. Defects in VDR are the cause of rickets vitamin D-dependent type 2A (VDDR2A). A disorder of vitamin D metabolism results in severe rickets, hypocalcemia and secondary hyperparathyroidism. Most patients have total alopecia in addition to rickets. The VDR exists two isoform with the MV 48 kDa and 54 kDa.