VDR Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 87335-1-RR (same clone as 87335-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87335-1-RR (VDR antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87335-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 87335-1-RR (same clone as 87335-1-PBS)

  T-47D cell lysates were subjected to SDS PAGE followed by western blot with 87335-1-RR (VDR antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87335-1-PBS in a different storage buffer formulation.

• 

  Sandwich ELISA sample test of MP03026-1

  The mean VDR concentration was determined to be 1,062.7 pg/mL in MCF-7 cell extract based on a 1.2 mg/mL extract load, 1,437.4 pg/mL in Jurkat cell extract based on a 1.2 mg/mL extract load and 407.7 pg/mL in SKOV-3 cell extract based on a 1.1 mg/mL extract load.

• 

  Sandwich ELISA standard curve of MP03026-1

  Sandwich ELISA standard curve of MP03026-1, Human VDR Recombinant Matched Antibody Pair - PBS only. 87335-1-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag28176. 87335-2-PBS was HRP conjugated as the detection antibody. Range: 39.1-2500 pg/mL.

• 

  IP experiment of HeLa using 87335-1-RR (same clone as 87335-1-PBS)

  IP result of anti-VDR (IP:87335-1-RR, 4ug; Detection:87335-1-RR 1:1500) with HeLa cells lysate 1320 ug. This data was developed using the same antibody clone with 87335-1-PBS in a different storage buffer formulation.

• 

  Affinity of 87335-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87335-1-RR against Human VDR were performed. The affinity constant is 2.01 nM.

VDR Uni-rAb^® Recombinant Antibody for WB, IP, Sandwich ELISA, Indirect ELISA

Cat No. 87335-1-PBS

Clone No.252576C4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, Sandwich ELISA, Indirect ELISA

Synonyms

NR1I1, Vitamin D3 receptor

---

Product Information

87335-1-PBS targets VDR as part of a matched antibody pair:

MP03026-1: 87335-1-PBS capture and 87335-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag28176

  Product name: Recombinant human VDR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 81-220 aa of BC060832

  Sequence: LKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSGDSSSSCSDHCITSSDMMDSSSFSNLDLSEEDSDDPSVTLE

• Full Name: vitamin D (1,25- dihydroxyvitamin D3) receptor
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC060832
• Gene Symbol: VDR
• Gene ID (NCBI): 7421
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P11473
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The vitamin D3 receptor (VDR), also known as NR1I1 (nuclear receptor subfamily 1, group I, member 1), is a member of the nuclear receptor family of transcription factors. Upon activation by vitamin D, the VDR forms a heterodimer with the retinoid-X receptor and binds to hormone response elements on DNA resulting in expression or trans-repression of specific gene products.It is an intracellular hormone receptor that specifically binds 1,25(OH)2D3 and mediates its effects. Downstream targets of this nuclear hormone receptor are principally involved in mineral metabolism though the receptor regulates a variety of other metabolic pathways, such as those involved in the immune response and cancer. Defects in VDR are the cause of rickets vitamin D-dependent type 2A (VDDR2A). A disorder of vitamin D metabolism results in severe rickets, hypocalcemia and secondary hyperparathyroidism. Most patients have total alopecia in addition to rickets. The VDR exists two isoform with the MV 48 kDa and 54 kDa.