VEGF-C Polyclonal antibody

VEGF-C Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 22601-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, ELISA

VEGFC, VEGF C, Vascular endothelial growth factor-related protein, vascular endothelial growth factor C

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inMCF-7 cells, RAW 264.7 cells, HCT 116 cells, SW480 cells
Positive IHC detected inhuman prostate cancer tissue, human lung cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inRAW 264.7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

22601-1-AP targets VEGF-C in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18182

Product name: Recombinant human VEGFC protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 179-228 aa of BC035212

Sequence: SYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRRS

Predict reactive species
Full Name vascular endothelial growth factor C
Calculated Molecular Weight 419 aa, 47 kDa
Observed Molecular Weight 47 kDa
GenBank Accession NumberBC035212
Gene Symbol VEGFC
Gene ID (NCBI) 7424
RRIDAB_2879132
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP49767
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

VEGFC is a member of the platelet-derived growth factor / vascular endothelial growth factor (PDGF/VEGF) family. The main function of VEGFC is to promote the growth of lymphatic vessels (lymphangiogenesis). It acts on lymphatic endothelial cells (LECs) primarily via its receptor VEGFR-3 promoting survival, growth, and migration.

Protocols

Product Specific Protocols
IF protocol for VEGF-C antibody 22601-1-APDownload protocol
IHC protocol for VEGF-C antibody 22601-1-APDownload protocol
WB protocol for VEGF-C antibody 22601-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Cancer Cell

Single-cell multi-stage spatial evolutional map of esophageal carcinogenesis

Authors - Jiang Chang
mouseWB,IHC

J Extracell Vesicles

DUSP2 regulates extracellular vesicle-VEGF-C secretion and pancreatic cancer early dissemination.

Authors - Chu-An Wang
mouseWB

Clin Transl Med

VEGF-C/VEGFR-3 axis protects against pressure-overload induced cardiac dysfunction through regulation of lymphangiogenesis.

Authors - Qiu-Yue Lin
humanWB, IHC, IF

Cancer Lett

The Hippo-TAZ axis mediates vascular endothelial growth factor C in glioblastoma-derived exosomes to promote angiogenesis.

Authors - Zhengmin Wang
mouseWB

Oxid Med Cell Longev

Angiotensin II Induces Cardiac Edema and Hypertrophic Remodeling through Lymphatic-Dependent Mechanisms.

Authors - Jie Bai
mouseIHC

Front Pharmacol

Fenofibrate suppresses corneal neovascularization by regulating lipid metabolism through PPARα signaling pathway

Authors - Tong Zhou

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Guorong (Verified Customer) (11-22-2022)

No bands were observed. Does not represent the performance in other kind of samples

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: ARPE-19
FH

hongxuan (Verified Customer) (11-12-2018)

we can detect the obvious signals in the embryo sections by using this primary antibody at a dilution of 1:50. Moreover, the background is very clear. Please forgive me that I cannot upload the files due to it's unpublished data.Thank you very much for you product.

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:50
  • Cell Tissue Type: mouse embryo
Loading...
||
New chat Able
正在加载,请稍候...