Tested Applications
| Positive WB detected in | MCF-7 cells, RAW 264.7 cells, HCT 116 cells, SW480 cells |
| Positive IHC detected in | human prostate cancer tissue, human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | RAW 264.7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 33 publications below |
| IHC | See 14 publications below |
| IF | See 9 publications below |
Product Information
22601-1-AP targets VEGF-C in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18182 Product name: Recombinant human VEGFC protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 179-228 aa of BC035212 Sequence: SYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRRS Predict reactive species |
| Full Name | vascular endothelial growth factor C |
| Calculated Molecular Weight | 419 aa, 47 kDa |
| Observed Molecular Weight | 47 kDa |
| GenBank Accession Number | BC035212 |
| Gene Symbol | VEGFC |
| Gene ID (NCBI) | 7424 |
| RRID | AB_2879132 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P49767 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
VEGFC is a member of the platelet-derived growth factor / vascular endothelial growth factor (PDGF/VEGF) family. The main function of VEGFC is to promote the growth of lymphatic vessels (lymphangiogenesis). It acts on lymphatic endothelial cells (LECs) primarily via its receptor VEGFR-3 promoting survival, growth, and migration.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for VEGF-C antibody 22601-1-AP | Download protocol |
| IHC protocol for VEGF-C antibody 22601-1-AP | Download protocol |
| WB protocol for VEGF-C antibody 22601-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Extracell Vesicles DUSP2 regulates extracellular vesicle-VEGF-C secretion and pancreatic cancer early dissemination. | ||
Clin Transl Med VEGF-C/VEGFR-3 axis protects against pressure-overload induced cardiac dysfunction through regulation of lymphangiogenesis. | ||
Cancer Lett The Hippo-TAZ axis mediates vascular endothelial growth factor C in glioblastoma-derived exosomes to promote angiogenesis. | ||
Oxid Med Cell Longev Angiotensin II Induces Cardiac Edema and Hypertrophic Remodeling through Lymphatic-Dependent Mechanisms. | ||
Front Pharmacol Fenofibrate suppresses corneal neovascularization by regulating lipid metabolism through PPARα signaling pathway |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Guorong (Verified Customer) (11-22-2022) | No bands were observed. Does not represent the performance in other kind of samples
|
FH hongxuan (Verified Customer) (11-12-2018) | we can detect the obvious signals in the embryo sections by using this primary antibody at a dilution of 1:50. Moreover, the background is very clear. Please forgive me that I cannot upload the files due to it's unpublished data.Thank you very much for you product.
|
