VEGFR2 Polyclonal antibody

• 

VEGFR2 Polyclonal Antibody for ELISA

Cat No. 22457-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IF, ELISA

Synonyms

CD309, Fetal liver kinase 1, FLK 1, FLK1, KDR, Kinase insert domain receptor, VEGFR, VEGFR 2, VEGFR2

---

Published Applications

• KD/KO: See 1 publications below
• WB: See 5 publications below
• IF: See 2 publications below

Product Information

22457-1-AP targets VEGFR2 in WB, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17934

  Product name: Recombinant human KDR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 20-358 aa of BC131822

  Sequence: ASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQDYRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGITRSDQGLYTCAASSGLMTKKNSTFVRVHEKPFVAFGSGMESLVEATVGERVRIPAKYLGYP

• Full Name: kinase insert domain receptor (a type III receptor tyrosine kinase)
• Calculated Molecular Weight: 1356 aa, 152 kDa
• GenBank Accession Number: BC131822
• Gene Symbol: KDR
• Gene ID (NCBI): 3791
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P35968
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Int J Mol Sci; A Novel Blood-Brain Barrier-Penetrating and Vascular-Targeting Chimeric Peptide Inhibits Glioma Angiogenesis; Authors - Lu Lu
mouse	WB,IF	Phytomedicine; Paeoniflorin binds to VEGFR2 to restore autophagy and inhibit apoptosis for podocyte protection in diabetic kidney disease through PI3K-AKT signaling pathway; Authors - Xian Wang ; KO Validated
human	WB	J Ethnopharmacol; Lycium barbarum polysaccharides attenuates high glucose-induced diabetic retinal angiogenesis by rescuing the expression of miR-15a-5p in RF/6A cells; Authors - Yafei Zhu
mouse,rat	WB,IF	Curr Med Sci; Catalpol Prevents Glomerular Angiogenesis Induced by Advanced Glycation End Products via Inhibiting Galectin-3; Authors - Wei-Xiang Sun
human	WB	Int J Biol Macromol; m5C modification of LINC00324 promotes angiogenesis in glioma through CBX3/VEGFR2 pathway; Authors - Aini Pan