Tested Applications
| Positive WB detected in | mouse eye tissue, human brain tissue, mouse brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
17684-1-AP targets VEZT in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag11786 Product name: Recombinant human VEZT protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 382-731 aa of BC064939 Sequence: VRSLQLHLKALLNEVIILEDELEKLVCTKETQELVSEAYPILEQKLKLIQPHVQASNNCWEEAISQVDKLLRRNTDKKGKPEIACENPHCTVVPLKQPTLHIADKDPIPEEQELEAYVDDIDIDSDFRKDDFYYLSQEDKERQKREHEESKRVLQELKSVLGFKASEAERQKWKQLLFSDHAVLKSLSPVDPVEPISNSEPSMNSDMGKVSKNDTEEESNKSATTDNEISRTEYLCENALEGKNKDNSSNEVFPQGAEERMCYQCESEDEPQADGSGLTTAPPTPRDSLQPSIKQRLARLQLSPDFTFTAGLAAEVAARSLSFTTMQEQTFGDEEEEQIIEENKNEIEEK Predict reactive species |
| Full Name | vezatin, adherens junctions transmembrane protein |
| Calculated Molecular Weight | 731 aa, 83 kDa |
| Observed Molecular Weight | 89 kDa, 125 kDa |
| GenBank Accession Number | BC064939 |
| Gene Symbol | VEZT |
| Gene ID (NCBI) | 55591 |
| RRID | AB_2213139 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9HBM0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Vezatin (VEZT) is an adherens junctions transmembrane protein which identified as a putative tumor suppressor. In case of Listeria infection, it promotes bacterial internalization by participating in myosin VIIa recruitment to the entry site. There're two isoforms with calculated MW 89 kDa and 65 kDa. With modification or glycosylation, the MW in Western blot detection will be presented as ~125 kDa and ~89 kDa (PMID: 11080149) or 65-71 kDa and 88-100 kDa (PMID: 20049712). There're some isoforms with MW less than 70 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for VEZT antibody 17684-1-AP | Download protocol |
| IP protocol for VEZT antibody 17684-1-AP | Download protocol |
| WB protocol for VEZT antibody 17684-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |











