VGLUT1 Polyclonal antibody

VGLUT1 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 29469-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

1, SLC17A7, BNPI, Brain-specific Na(+)-dependent inorganic phosphate cotransporter

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inunboiled mouse brain tissue, unboiled rat cerebellum tissue
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:12000
Immunohistochemistry (IHC)IHC : 1:300-1:1200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

29469-1-AP targets VGLUT1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag31193

Product name: Recombinant human VGLUT1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 500-560 aa of NM_020309

Sequence: PEEMSEEKCGFVGHDQLAGSDDSEMEDEAEPPGAPPAPPPSYGATHSTFQPPRPPPPVRDY

Predict reactive species
Full Name solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 7
Calculated Molecular Weight 62 kDa
Observed Molecular Weight55-60 kDa
GenBank Accession NumberNM_020309
Gene Symbol VGLUT1
Gene ID (NCBI) 57030
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9P2U7
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Vesicular glutamate transporter 1 (VGLUT1) is a critical protein involved in the packaging and release of the neurotransmitter glutamate in synaptic vesicles. VGLUT1 is predominantly expressed in neurons that release glutamate, the primary excitatory neurotransmitter in the central nervous system, it is a marker of glutamatergic neurons. VGLUT1 has several isoforms with the moleculat weight range from 53-61 kDa.

VGLUT1 is a multiple transmembrane protein, which is easily to aggregate if the sample is bolied or treated with high temperature, thus we recommend to use unboiled sample for the detection.

Protocols

Product Specific Protocols
IHC protocol for VGLUT1 antibody 29469-1-APDownload protocol
WB protocol for VGLUT1 antibody 29469-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...