VGLUT1 Polyclonal antibody, PBS Only

VGLUT1 Polyclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 29469-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

1, SLC17A7, BNPI, Brain-specific Na(+)-dependent inorganic phosphate cotransporter

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

29469-1-PBS targets VGLUT1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag31193

Product name: Recombinant human VGLUT1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 500-560 aa of NM_020309

Sequence: PEEMSEEKCGFVGHDQLAGSDDSEMEDEAEPPGAPPAPPPSYGATHSTFQPPRPPPPVRDY

Predict reactive species
Full Name solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 7
Calculated Molecular Weight 62 kDa
Observed Molecular Weight55-60 kDa
GenBank Accession NumberNM_020309
Gene Symbol VGLUT1
Gene ID (NCBI) 57030
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9P2U7
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Vesicular glutamate transporter 1 (VGLUT1) is a critical protein involved in the packaging and release of the neurotransmitter glutamate in synaptic vesicles. VGLUT1 is predominantly expressed in neurons that release glutamate, the primary excitatory neurotransmitter in the central nervous system, it is a marker of glutamatergic neurons. VGLUT1 has several isoforms with the moleculat weight range from 53-61 kDa.

VGLUT1 is a multiple transmembrane protein, which is easily to aggregate if the sample is bolied or treated with high temperature, thus we recommend to use unboiled sample for the detection.

Loading...
||
New chat Able
正在加载,请稍候...