VGLUT1 Polyclonal antibody, PBS Only

• 

  WB analysis using 29469-1-AP (same clone as 29469-1-PBS)

  Various tissue were subjected to SDS PAGE followed by western blot with 29469-1-AP (VGLUT1 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29469-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 29469-1-AP (same clone as 29469-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 29469-1-AP (VGLUT1 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29469-1-PBS in a different storage buffer formulation.

VGLUT1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 29469-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

1, SLC17A7, BNPI, Brain-specific Na(+)-dependent inorganic phosphate cotransporter

---

Product Information

29469-1-PBS targets VGLUT1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31193

  Product name: Recombinant human VGLUT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 500-560 aa of NM_020309

  Sequence: PEEMSEEKCGFVGHDQLAGSDDSEMEDEAEPPGAPPAPPPSYGATHSTFQPPRPPPPVRDY

• Full Name: solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 7
• Calculated Molecular Weight: 62 kDa
• Observed Molecular Weight: 55-60 kDa
• GenBank Accession Number: NM_020309
• Gene Symbol: VGLUT1
• Gene ID (NCBI): 57030
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P2U7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Vesicular glutamate transporter 1 (VGLUT1) is a critical protein involved in the packaging and release of the neurotransmitter glutamate in synaptic vesicles. VGLUT1 is predominantly expressed in neurons that release glutamate, the primary excitatory neurotransmitter in the central nervous system, it is a marker of glutamatergic neurons. VGLUT1 has several isoforms with the moleculat weight range from 53-61 kDa.

VGLUT1 is a multiple transmembrane protein, which is easily to aggregate if the sample is bolied or treated with high temperature, thus we recommend to use unboiled sample for the detection.