Tested Applications
| Positive WB detected in | Jurkat cells, HeLa cells, Raji cells |
| Positive IHC detected in | human kidney tissue, human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 19 publications below |
| IHC | See 3 publications below |
| IF | See 3 publications below |
| IP | See 1 publications below |
| CoIP | See 2 publications below |
Product Information
24756-1-AP targets VHL in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21447 Product name: Recombinant human VHL protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 90-172 aa of BC058831 Sequence: NFDGEPQPYPTLPPGTGRRIYSYRVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD Predict reactive species |
| Full Name | von Hippel-Lindau tumor suppressor |
| Calculated Molecular Weight | 172 aa, 20 kDa |
| Observed Molecular Weight | 18-24 kDa |
| GenBank Accession Number | BC058831 |
| Gene Symbol | VHL |
| Gene ID (NCBI) | 7428 |
| RRID | AB_2879705 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P40337 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
VHL (von Hippel-Lindau tumor suppressor) gene was identified as the tumor suppressor gene whose germ line mutations are associated with the inherited von Hippel-Lindau cancer syndrome (PMID: 8603073, 10722748). VHL patients develop a wide variety of tumors including retinal angioma, central nervous system hemangioblastoma, pheochromocytoma, and renal clear cell carcinoma (PMID: 10722748). VHL localizes predominantly to the cytoplasmic compartment but engages in a dynamic nuclear-cytoplasmic shuttle (PMID: 8700833, 9891082, 12101228). VHL has 3 isoforms with the molecular mass of 24, 20 and 18 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for VHL antibody 24756-1-AP | Download protocol |
| IHC protocol for VHL antibody 24756-1-AP | Download protocol |
| WB protocol for VHL antibody 24756-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Front Oncol Hypoxia-Induced LncRNA-MIR210HG Promotes Cancer Progression By Inhibiting HIF-1α Degradation in Ovarian Cancer. | ||
Microvasc Res A positive feedback loop between miR-574-3p and HIF-1α in promoting angiogenesis under hypoxia | ||
Cell Death Discov Septin4 promotes cardiomyocytes apoptosis by enhancing the VHL-mediated degradation of HIF-1α. | ||
Clin Mol Hepatol UBE2S promotes glycolysis in hepatocellular carcinoma by enhancing E3 enzyme-independent polyubiquitination of VHL | ||
Adv Sci (Weinh) RPL6 Interacts with HMGCS1 to Stabilize HIF-1α by Promoting Cholesterol Production in Hepatocellular Carcinoma | ||
Cell Death Differ USP51 facilitates colorectal cancer stemness and chemoresistance by forming a positive feed-forward loop with HIF1A |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH S (Verified Customer) (11-22-2021) | This antibody didn't work in my hands. There are too many non-specific bands to identify the VHL band.
![]() |
















