VIPR1 Polyclonal antibody, PBS Only

• 

  WB analysis of mouse small intestine using 14878-1-AP (same clone as 14878-1-PBS)

  mouse small intestine tissue were subjected to SDS PAGE followed by western blot with 14878-1-AP (VIPR1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14878-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 14878-1-AP (same clone as 14878-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 14878-1-AP (VIPR1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14878-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 14878-1-AP (same clone as 14878-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 14878-1-AP (VIPR1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14878-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 14878-1-AP (same clone as 14878-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14878-1-AP (VIPR1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14878-1-PBS in a different storage buffer formulation.

VIPR1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 14878-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

14878-1-PBS targets VIPR1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6650

  Product name: Recombinant human VIPR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 30-146 aa of BC064424

  Sequence: AARLQEECDYVQMIEVQHKQCLEEAQLENETIGCSKMWDNLTCWPATPRGQVVVLACPLIFKLFSSIQGRNVSRSCTDEGWTHLEPGPYPIACGLDDKAASLDEQQTMFYGSVKTGY

• Full Name: vasoactive intestinal peptide receptor 1
• Calculated Molecular Weight: 47 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC064424
• Gene Symbol: VIPR1
• Gene ID (NCBI): 7433
• RRID: AB_2878089
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P32241
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

VIPR1(vasoactive intestinal polypeptide receptor 1) is a class B GPCR expressed predominantly in lung, small intestine, thymus, and brain. VIPR1 and its endogenous agonist VIP (28 AA polypeptide) have been reported to be overexpressed in several tumors (PMID: 22365758).