VIPR1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• VIPR1 Polyclonal antibody (14878-1-AP)

VIPR1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 14878-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

HVR1, II, PACAP R 2, PACAP R2, PACAP type II receptor, RDC1, VAPC1, VIP R 1, VIPR, VIPR1, VIRG, VPAC1, VPCAP1R

• 

  WB analysis of mouse small intestine using 14878-1-AP

  mouse small intestine tissue were subjected to SDS PAGE followed by western blot with 14878-1-AP (VIPR1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 14878-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 14878-1-AP (VIPR1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 14878-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 14878-1-AP (VIPR1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 14878-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14878-1-AP (VIPR1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for VIPR1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse small intestine tissue
• Positive IHC detected in: human kidney tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14878-1-AP targets VIPR1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6650

  Product name: Recombinant human VIPR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 30-146 aa of BC064424

  Sequence: AARLQEECDYVQMIEVQHKQCLEEAQLENETIGCSKMWDNLTCWPATPRGQVVVLACPLIFKLFSSIQGRNVSRSCTDEGWTHLEPGPYPIACGLDDKAASLDEQQTMFYGSVKTGY

• Full Name: vasoactive intestinal peptide receptor 1
• Calculated Molecular Weight: 47 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC064424
• Gene Symbol: VIPR1
• Gene ID (NCBI): 7433
• RRID: AB_2878089
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P32241
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The VIPR1 Polyclonal antibody (Cat# 14878-1-AP) has 2 total citations. One appears in International Immunopharmacology (2023), studying the p65 regulatory loop in vasoactive intestinal peptide effects on osteoarthritis chondrocytes using WB in mouse. The other is in PLoS One (2025), identifying oxidative stress-responsive genes in recurrent miscarriage using IHC in human. The associated research fields are immunopharmacology/osteoarthritis and reproductive medicine/oxidative stress.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Int Immunopharmacol; The p65-LOC727924-miR-26a/KPNA3-p65 regulatory loop mediates vasoactive intestinal peptide effects on osteoarthritis chondrocytes; Authors - Yusheng Li
human	IHC	PLoS One; Identification of oxidative stress-responsive genes in recurrent miscarriage and their role in disease pathogenesis.; Authors - Mian Wang