Tested Applications
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24659-1-AP targets VN1R3 in IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20382 Product name: Recombinant human VN1R3 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 242-311 aa of BC107074 Sequence: STLCYFTRSPPSLHMSLFPNPSWWLLNTSALITACFPMVSPFVLMSRHPRIPRLGSACCGRNPQFPKLVR Predict reactive species |
| Full Name | vomeronasal 1 receptor 3 pseudogene |
| Calculated Molecular Weight | 311 aa, 35 kDa |
| GenBank Accession Number | BC107074 |
| Gene Symbol | VN1R3 |
| Gene ID (NCBI) | 317702 |
| RRID | AB_2879660 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BXE9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
VN1R3, also named as V1RL3, is a pheromone receptor. We always got 55-65 kDa in our detection.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for VN1R3 antibody 24659-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







