VN1R3 Polyclonal antibody, PBS Only

• 

  IHC staining of human liver cancer using 24659-1-AP (same clone as 24659-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer slide using 24659-1-AP (VN1R3 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 24659-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 24659-1-AP (same clone as 24659-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer slide using 24659-1-AP (VN1R3 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 24659-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 24659-1-AP (same clone as 24659-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 24659-1-AP (VN1R3 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24659-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 24659-1-AP (same clone as 24659-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 24659-1-AP (VN1R3 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24659-1-PBS in a different storage buffer formulation.

VN1R3 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 24659-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

24659-1-PBS targets VN1R3 in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20382

  Product name: Recombinant human VN1R3 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 242-311 aa of BC107074

  Sequence: STLCYFTRSPPSLHMSLFPNPSWWLLNTSALITACFPMVSPFVLMSRHPRIPRLGSACCGRNPQFPKLVR

• Full Name: vomeronasal 1 receptor 3 pseudogene
• Calculated Molecular Weight: 311 aa, 35 kDa
• GenBank Accession Number: BC107074
• Gene Symbol: VN1R3
• Gene ID (NCBI): 317702
• RRID: AB_2879660
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BXE9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

VN1R3, also named as V1RL3, is a pheromone receptor. We always got 55-65 kDa in our detection.