• Featured Product
  • KD/KO Validated

VPS35 Polyclonal antibody

VPS35 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10236-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

hVPS35, Maternal embryonic 3, Maternal-embryonic 3, MEM3, TCCCTA00141

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, A549 cells, HAP1 cells, HEK-293 cells, mouse kidney tissue, rat kidney tissue
Positive IP detected inHEK-293 cells
Positive IHC detected inmouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10236-1-AP targets VPS35 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, monkey
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0340

Product name: Recombinant human VPS35 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-200 aa of BC002414

Sequence: MPTTQQSPQDEQEKLLDEAIQAVKVQSFQMKRCLDKNKLMDALKHASNMLGELRTSMLSPKSYYELYMAISDELHYLEVYLTDEFAKGRKVADLYELVQYAGNIIPRLYLLITVGVVYVKSFPQSRKDILKDLVEMCRGVQHPLRGLFLRNYLLQCTRNILPDEGEPTDEETTGDISDSMDFVLLNFAEMNKLWVRMQHQ

Predict reactive species
Full Name vacuolar protein sorting 35 homolog (S. cerevisiae)
Calculated Molecular Weight 92 kDa
Observed Molecular Weight80-92 kDa
GenBank Accession NumberBC002414
Gene Symbol VPS35
Gene ID (NCBI) 55737
RRIDAB_2215216
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96QK1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

VPS35 protein belongs to a group of vacuolar protein sorting (VPS) proteins, which ensure the proper delivery of organelle-specific proteins in eukaryotic cells. VPS35 is the core of a multimeric complex, termed the retromer complex, which is involved in retrograde transport of proteins from endosomes to the trans-Golgi network. Vps35 serves as the core of the multimeric complex by binding directly to Vps26 and Vps29 and SNX1. Northern blot analyses in 16 tissues showed that one transcript of Vps35 with a size of 3.6 kb was highly expressed in brain, heart, testis, ovary, small intestine, spleen, skeletal muscle, and placenta and expressed at moderate or low levels in other tissues. Another transcript of Vps35, a message of 3.0 kb, was also expressed with proportionally lower levels than the 3.6-kb transcript in all the tissues except that the 3.0-kb transcript was not detected in brain. Human Vps35 is mapped at 16q13-q21.

Protocols

Product Specific Protocols
IF protocol for VPS35 antibody 10236-1-APDownload protocol
IHC protocol for VPS35 antibody 10236-1-APDownload protocol
IP protocol for VPS35 antibody 10236-1-APDownload protocol
WB protocol for VPS35 antibody 10236-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Nat Commun

A genome-wide CRISPR screen identifies host factors that regulate SARS-CoV-2 entry.

Authors - Yunkai Zhu
ratWB,IF,CoIP

Cell Death Differ

Sorting nexin 3 induces heart failure via promoting retromer-dependent nuclear trafficking of STAT3.

Authors - Jing Lu
humanIF

Proc Natl Acad Sci U S A

SNX27 suppresses SARS-CoV-2 infection by inhibiting viral lysosome/late endosome entry.

Authors - Bo Yang
WB

Hum Mol Genet

VPS35 pathogenic mutations confer no dominant toxicity but partial loss of function in Drosophila and genetically interact with parkin.

Authors - Bilal R Malik
monkeyWB,IF

Am J Pathol

Dynein Dysfunction Reproduces Age-Dependent Retromer Deficiency: Concomitant Disruption of Retrograde Trafficking Is Required for Alteration in β-Amyloid Precursor Protein Metabolism.

Authors - Nobuyuki Kimura
mouseWB

J Neurochem

Retromer and Rab2-dependent trafficking mediate PS1 degradation by proteasomes in endocytic disturbance.

Authors - Naoya Ueda
  • KD Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Xin (Verified Customer) (10-10-2022)

A very good antibody to detect endogenous VPS35 in mouse brain lysate.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: mouse brain lysate
VPS35 Antibody Western Blot validation (1:2000 dilution) in mouse brain lysate (Cat no:10236-1-AP)
FH

stephen (Verified Customer) (09-07-2019)

Oc-2 cells fixed with 4% PFA Perm. by 0.3% tx100 for 5 min blocked with 1% BSA in 1XPBS for 2 hours vps35 antibody incubated 1:300 overnight at 4 degrees in 1%BSA in 1x PBS. Co-stained with DAPI (blue) and Ph647 (red) to visualize DNA and F-actin respectively.

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:300
  • Cell Tissue Type: mouse OC2 cells
VPS35 Antibody Immunofluorescence, validation (1:300 dilution) in mouse OC2 cells (Cat no:10236-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...