VPS54 Polyclonal antibody, PBS Only

• 

  WB analysis of human brain using 13327-1-AP (same clone as 13327-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 13327-1-AP (VPS54 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13327-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 13327-1-AP (same clone as 13327-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13327-1-AP (VPS54 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13327-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 13327-1-AP (same clone as 13327-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 13327-1-AP (VPS54 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13327-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 13327-1-AP (same clone as 13327-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 13327-1-AP (VPS54 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13327-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 13327-1-AP (same clone as 13327-1-PBS)

  IP result of anti-VPS54 (IP:13327-1-AP, 4ug; Detection:13327-1-AP 1:300) with mouse brain tissue lysate 4000ug. This data was developed using the same antibody clone with 13327-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

VPS54 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 13327-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

HCC8, Hepatocellular carcinoma protein 8, Tumor antigen HOM-HCC-8, Tumor antigen SLP-8p, Vacuolar protein sorting-associated protein 54

---

Product Information

13327-1-PBS targets VPS54 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4123

  Product name: Recombinant human VPS54 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 746-965 aa of BC030275

  Sequence: CVDNIPSVTTDMLTRLSDLLKYFNSRSCQLVLGAGALQVVGLKTITTKNLALSSRCLQLIVHYIPVIRAHFEARLPPKQYSMLRHFDHITKDYHDHIAEISAKLVAIMDSLFDKLLSKYEVKAPVPSACFRNICKQMTKMHEAIFDLLPEEQTQMLFLRINASYKLHLKKQLSHLNVINDGGPQNGLVTADVAFYTGNLQALKGLKDLDLNMAEIWEQKR

• Full Name: vacuolar protein sorting 54 homolog (S. cerevisiae)
• Calculated Molecular Weight: 977 aa, 111 kDa
• Observed Molecular Weight: 90-93kDa, 111 kDa
• GenBank Accession Number: BC030275
• Gene Symbol: VPS54
• Gene ID (NCBI): 51542
• RRID: AB_2304414
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P1Q0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

VPS54 is a part of the Golgi-associated retrograde protein (GARP) complex protein required for tethering and fusion of endosome-derived transport vesicles to the trans-Golgi network. It may particpate in retrograde transport from early and late endosomes to the late Golgi. The GARP complex is required for the maintenance of the cycling of mannose 6-phosphate receptors between the TGN and endosomes, this cycling is necessary for proper lysosomal sorting of acid hydrolases such as CTSD.