Tested Applications
| Positive WB detected in | human stomach tissue | 
| Positive IHC detected in | human stomach tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 | 
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below | 
Product Information
14145-1-AP targets VSIG1 in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human | 
| Cited Reactivity | human | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag5314 Product name: Recombinant human VSIG1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 256-387 aa of BC043216 Sequence: FARNKAKAKAKERNSKTIAELEPMTKINPRGESEAMPREDATQLEVTLPSSIHETGPDTIQEPDYEPKPTQEPAPEPAPGSEPMAVPDLDIELELEPETQSELEPEPEPEPESEPGVVVEPLSEDEKGVVKA Predict reactive species | 
                                    
| Full Name | V-set and immunoglobulin domain containing 1 | 
| Calculated Molecular Weight | 387 aa, 42 kDa | 
| Observed Molecular Weight | 65-70 kDa | 
| GenBank Accession Number | BC043216 | 
| Gene Symbol | VSIG1 | 
| Gene ID (NCBI) | 340547 | 
| RRID | AB_2272980 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q86XK7 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for VSIG1 antibody 14145-1-AP | Download protocol | 
| WB protocol for VSIG1 antibody 14145-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
Cell Cycle Downregulation of cancer-associated fibroblast exosome-derived miR-29b-1-5p restrains vasculogenic mimicry and apoptosis while accelerating migration and invasion of gastric cancer cells via immunoglobulin domain-containing 1/zonula occluden-1 axis | 













