VILIP1 Monoclonal antibody

• 

  WB analysis of human brain using 67134-1-Ig

  human brain tissue were subjected to SDS PAGE followed by western blot with 67134-1-Ig (VSNL1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat brain using 67134-1-Ig

  rat brain tissue were subjected to SDS PAGE followed by western blot with 67134-1-Ig (VSNL1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 67134-1-Ig

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 67134-1-Ig (VSNL1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 67134-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67134-1-Ig (VSNL1 antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 67134-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67134-1-Ig (VSNL1 antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

VILIP1 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67134-1-Ig

Clone No.2C6C3

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, ELISA

Synonyms

VILIP 1, VILIP-1, VSNL1, 2C6C3, Hippocalcin like protein 3

---

Tested Applications

• Positive WB detected in: human brain tissue, rat brain tissue, mouse brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:150-1:600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below

Product Information

67134-1-Ig targets VILIP1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4923

  Product name: Recombinant human VSNL1 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-191 aa of BC022012

  Sequence: MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK

• Full Name: visinin-like 1
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC022012
• Gene Symbol: VSNL1
• Gene ID (NCBI): 7447
• RRID: AB_2882433
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P62760
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Visinin-like protein 1 (VILIP1) is also named VLP-1, hippocalcin-like protein 3 (HLP3), VSNL1 and VISL1. The neuronal calcium sensor protein VILIP1 forms a complex with neurotransmitter-gated P2X2 receptors, functions as a channel regulator, and likely binds more tightly to P2X2 receptors in an activation- and calcium-dependent manner (PMID: 18922787). VILIP1 is widely expressed and involved in physiological and disease processes throughout the body, including tumor formation (PMID: 17311005, PMID: 18301774). VILIP1 is localized primarily in the rat hippocampus, where it controls neuronal excitability important for learning and memory (PMID: 18440708, PMID: 15336574). In particular, VILIP1 binds to the α-subunit of the α4β2 nicotinic acetylcholine receptor (nAChR), which promotes its surface expression and trafficking in oocytes and hippocampal neurons (PMID: 1220248, PMID: 19063970).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Biomedicines; Characteristic Analysis of Featured Genes Associated with Cholangiocarcinoma Progression; Authors - Qigu Yao