Use Able AI chat for product recommendations

VILIP1 Monoclonal antibody, PBS Only

VILIP1 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67134-1-PBS
Clone No.2C6C3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, Indirect ELISA

VILIP 1, VILIP-1, VSNL1, 2C6C3, Hippocalcin like protein 3

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67134-1-PBS targets VILIP1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag4923

Product name: Recombinant human VSNL1 protein

Source: e coli.-derived, T-HIS

Tag: 6*His

Domain: 1-191 aa of BC022012

Sequence: MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK

Predict reactive species
Full Name visinin-like 1
Calculated Molecular Weight 22 kDa
Observed Molecular Weight 20 kDa
GenBank Accession NumberBC022012
Gene Symbol VSNL1
Gene ID (NCBI) 7447
RRIDAB_2882433
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP62760
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Visinin-like protein 1 (VILIP1) is also named VLP-1, hippocalcin-like protein 3 (HLP3), VSNL1 and VISL1. The neuronal calcium sensor protein VILIP1 forms a complex with neurotransmitter-gated P2X2 receptors, functions as a channel regulator, and likely binds more tightly to P2X2 receptors in an activation- and calcium-dependent manner (PMID: 18922787). VILIP1 is widely expressed and involved in physiological and disease processes throughout the body, including tumor formation (PMID: 17311005, PMID: 18301774). VILIP1 is localized primarily in the rat hippocampus, where it controls neuronal excitability important for learning and memory (PMID: 18440708, PMID: 15336574). In particular, VILIP1 binds to the α-subunit of the α4β2 nicotinic acetylcholine receptor (nAChR), which promotes its surface expression and trafficking in oocytes and hippocampal neurons (PMID: 1220248, PMID: 19063970).

Loading...
||
New chat

Able

正在加载,请稍候...