VILIP1 Monoclonal antibody, PBS Only

• 

  WB analysis of human brain using 67134-1-Ig (same clone as 67134-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 67134-1-Ig (VSNL1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67134-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 67134-1-Ig (same clone as 67134-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 67134-1-Ig (VSNL1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67134-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 67134-1-Ig (same clone as 67134-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 67134-1-Ig (VSNL1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67134-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 67134-1-Ig (same clone as 67134-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67134-1-Ig (VSNL1 antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67134-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 67134-1-Ig (same clone as 67134-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67134-1-Ig (VSNL1 antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67134-1-PBS in a different storage buffer formulation.

VILIP1 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67134-1-PBS

Clone No.2C6C3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, Indirect ELISA

Synonyms

VILIP 1, VILIP-1, VSNL1, 2C6C3, Hippocalcin like protein 3

---

Product Information

67134-1-PBS targets VILIP1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4923

  Product name: Recombinant human VSNL1 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-191 aa of BC022012

  Sequence: MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK

• Full Name: visinin-like 1
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC022012
• Gene Symbol: VSNL1
• Gene ID (NCBI): 7447
• RRID: AB_2882433
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P62760
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.