VSTM1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• VSTM1 Polyclonal antibody (24382-1-AP)

VSTM1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 24382-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IP, ELISA

Synonyms

Signal inhibitory receptor on leukocytes-1, SIRL-1, UNQ3033/PRO9835, V-set and transmembrane domain-containing protein 1

• 

  WB analysis using 24382-1-AP

  human peripheral blood leukocytes were subjected to SDS PAGE followed by western blot with 24382-1-AP (VSTM1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HL-60 using 24382-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 24382-1-AP (VSTM1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 24382-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 24382-1-AP (VSTM1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 24382-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 24382-1-AP (VSTM1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for VSTM1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human peripheral blood leukocyte, HL-60 cells
• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24382-1-AP targets VSTM1 in WB, IHC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15799

  Product name: Recombinant human VSTM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 14-140 aa of BC100942

  Sequence: CLGYEDEKKNEKPPKPSLHAWPSSVVEAESNVTLKCQAHSQNVTFVLRKVNDSGYKQEQSSAENEAEFPFTDLKPKDAGRYFCAYKTTASHEWSESSEHLQLVVTDKHDELEAPSMKTDTRTIFVAI

• Full Name: V-set and transmembrane domain containing 1
• Calculated Molecular Weight: 236 aa, 26 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC100942
• Gene Symbol: VSTM1
• Gene ID (NCBI): 284415
• RRID: AB_2879516
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6UX27
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

VSTM1 (V-set and transmembrane domain-containing protein 1) has two main splicing isoforms, VSTM1-v1 and VSTM1-v2. VSTM1-v1 is a type I membrane molecule, mainly expressed on human peripheral blood granulocytes and monocytes. VSTM1-v2 is a classical secretory glycoprotein mainly expressed in immune tissues, and can promote the differentiation and activation of Th17 cells. (PMID: 22960280; 23909423)

Publications

What published studies show

The VSTM1 Polyclonal antibody (Cat# 24382-1-AP) has 1 citation to date. It appears in Cellular & Molecular Immunology (2023), a study investigating how oxidized galectin-1 in systemic lupus erythematosus (SLE) fails to bind the inhibitory receptor VSTM1, leading to increased reactive oxygen species levels in neutrophils. The associated research fields include autoimmune disease, innate immunity, and oxidative stress signaling.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IP	Cell Mol Immunol; Oxidized galectin-1 in SLE fails to bind the inhibitory receptor VSTM1 and increases reactive oxygen species levels in neutrophils; Authors - Xu Jiang