VSTM1 Polyclonal antibody

• 

  WB analysis using 24382-1-AP

  human peripheral blood leukocytes were subjected to SDS PAGE followed by western blot with 24382-1-AP (VSTM1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HL-60 using 24382-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 24382-1-AP (VSTM1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human tonsillitis using 24382-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 24382-1-AP (VSTM1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 24382-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 24382-1-AP (VSTM1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

VSTM1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 24382-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, IHC, ELISA

Synonyms

UNQ3033, VSTM1

---

Tested Applications

• Positive WB detected in: human peripheral blood leukocyte, HL-60 cells
• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IP: See 1 publications below

Product Information

24382-1-AP targets VSTM1 in WB, IP, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15799

  Product name: Recombinant human VSTM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 14-140 aa of BC100942

  Sequence: CLGYEDEKKNEKPPKPSLHAWPSSVVEAESNVTLKCQAHSQNVTFVLRKVNDSGYKQEQSSAENEAEFPFTDLKPKDAGRYFCAYKTTASHEWSESSEHLQLVVTDKHDELEAPSMKTDTRTIFVAI

• Full Name: V-set and transmembrane domain containing 1
• Calculated Molecular Weight: 236 aa, 26 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC100942
• Gene Symbol: VSTM1
• Gene ID (NCBI): 284415
• RRID: AB_2879516
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6UX27
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

VSTM1 (V-set and transmembrane domain-containing protein 1) has two main splicing isoform, VSTM1-v1 and VSTM1-v2. VSTM1-v1 is a type I membrane molecule, mainly expressed on human peripheral blood granulocytes and monocytes. VSTM1-v2 is a classical secretory glycoprotein mainly expressed in immune tissues, and can promote the differentiation and activation of Th17 cells. (PMID: 22960280; 23909423)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IP	Cell Mol Immunol; Oxidized galectin-1 in SLE fails to bind the inhibitory receptor VSTM1 and increases reactive oxygen species levels in neutrophils; Authors - Xu Jiang