VSX2 Monoclonal antibody, PBS Only

• 

  WB analysis using 67626-1-Ig (same clone as 67626-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67626-1-Ig (VSX2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 67626-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat eye using 67626-1-Ig (same clone as 67626-1-PBS)

  rat eye tissue were subjected to SDS PAGE followed by western blot with 67626-1-Ig (VSX2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67626-1-PBS in a different storage buffer formulation.

VSX2 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67626-1-PBS

Clone No.2C7C1

Host / Isotype

Mouse / IgG2b

Reactivity

Human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

CHX10, Homeobox protein CHX10, HOX10, MCOP2, MCOPCB3, RET1, visual system homeobox 2, VSX2

---

Product Information

67626-1-PBS targets VSX2 in WB, Indirect ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29867

  Product name: Recombinant human VSX2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-147 aa of BC128153

  Sequence: MTGKAGEALSKPKSETVAKSTSGGAPARCTGFGIQEILGLNKEPPSSHPRAALDGLAPGHLLAARSVLSPAGVGGMGLLGPGGLPGFYTQPTFLEVLSDPQSVHLQPLGRASGPLDTSQTASSDSEDVSSSDRKMSKSALNQTKKRK

• Full Name: visual system homeobox 2
• Calculated Molecular Weight: 361 aa, 39 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC128153
• Gene Symbol: VSX2
• Gene ID (NCBI): 338917
• RRID: AB_2882827
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P58304
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

VSX2, also named as CHX10 and HOX10, belongs to the paired homeobox family. VSX2 plays a significant role in the specification and morphogenesis of the sensory retina. It may also participate in the development of the cells of the inner nuclear layer, particularly bipolar cells. Defects in VSX2 are the cause of microphthalmia isolated type 2 (MCOP2). Defects in VSX2 are the cause of microphthalmia with cataracts and iris abnormalities (MCOPCTI). Defects in VSX2 are the cause of microphthalmia isolated with coloboma type 3 (MCOPCB3). The antibody is specific to VSX2.