WBP11 Polyclonal antibody, PBS Only

• 

  WB analysis using 10316-1-AP (same clone as 10316-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10316-1-AP (WBP11 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10316-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse heart using 10316-1-AP (same clone as 10316-1-PBS)

  IP result of anti-WBP11 (IP:10316-1-AP, 3ug; Detection:10316-1-AP 1:500) with mouse heart tissue lysate 6000ug. This data was developed using the same antibody clone with 10316-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 10316-1-AP (same clone as 10316-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10316-1-AP (WBP11 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10316-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 10316-1-AP (same clone as 10316-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10316-1-AP (WBP11 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10316-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 10316-1-AP (same clone as 10316-1-PBS)

  Immunofluorescent analysis of HeLa cells using 10316-1-AP (WBP11 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 10316-1-PBS in a different storage buffer formulation.

WBP11 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 10316-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

10316-1-PBS targets WBP11 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0366

  Product name: Recombinant human WBP11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 170-379 aa of BC001621

  Sequence: TSAYGPPTRAVSILPLLGHGVPRLPPGRKPPGPPPGPPPPQVVQMYGRKVGFALDLPPRRRDEDMLYSPELAQRGHDDDVSSTSEDDGYPEDMDQDKHDDSTDDSDTDKSDGESDGDEFVHRDNGERDNNEEKKSGLSVRFADMPGKSRKKKKNMKELTPLQAMMLRMAGQEIPEEGREVEEFSEDDDEDDSDDSEAEKQSQKQHKEESH

• Full Name: WW domain binding protein 11
• Calculated Molecular Weight: 70 kDa
• Observed Molecular Weight: 66-70 kDa
• GenBank Accession Number: BC001621
• Gene Symbol: WBP11
• Gene ID (NCBI): 51729
• RRID: AB_10694664
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y2W2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

WBP11 (WW domain-binding protein 11) is a protein that in humans, is encoded by the WBP11 gene. The function of WBP11 is to play a role in the regulation of pre-mRNA processing. More specifically, this nuclear protein, colocalizes with mRNA splicing factors and intermediate filament-containing perinuclear networks. The predicted MW of this protein is 70 kDa, and this antibody specially recognises the 70 kDa protein.