WDFY2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• WDFY2 Polyclonal antibody (17197-1-AP)

• 

  WB analysis using 17197-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17197-1-AP (WDFY2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 17197-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using WDFY2 antibody (17197-1-AP) at dilution of 1:200 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).

WDFY2 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 17197-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, ELISA

Synonyms

Prof, Propeller-FYVE protein, WD repeat and FYVE domain-containing protein 2, WD40- and FYVE domain-containing protein 2, WDF2

---

Tested Applications

• Positive WB detected in: L-929 cells, 3T3-L1 cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17197-1-AP targets WDFY2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10415

  Product name: Recombinant human WDFY2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 72-400 aa of BC014004

  Sequence: SCMSFNPETRRLSIGLDNGTISEFILSEDYNKMTPVKNYQAHQSRVTMILFVLELEWVLSTGQDKQFAWHCSESGQRLGGYRTSAVASGLQFDVETRHVFIGDHSGQVTILKLEQENCTLVTTFRGHTGGVTALCWDPVQRVLFSGSSDHSVIMWDIGGRKGTAIELQGHNDRVQALSYAQHTRQLISCGGDGGIVVWNMDVERQETPEWLDSDSCQKCDQPFFWNFKQMWDSKKIGLRQHHCRKCGKAVCGKCSSKRSSIPLMGFEFEVRVCDSCHEAITDEERAPTATFHDSKHNIVHVHFDATRGWLLTSGTDKVIKLWDMTPVVS

• Full Name: WD repeat and FYVE domain containing 2
• Calculated Molecular Weight: 400 aa, 45 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC014004
• Gene Symbol: WDFY2
• Gene ID (NCBI): 115825
• RRID: AB_3741909
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96P53
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

WDFY2, also named Prof, is a protein that contains WD repeats and an FYVE domain. WDFY2 regulates the membrane-bound matrix metalloproteinase MT1-MMP (MMP14) efflux by controlling endosome sorting. WDFY2 may act as a tumor suppressor by limiting VAMP3-dependent recycling to inhibit matrix metalloproteinase secretion and cell invasion (PMID: 31253801). WDFY2 in the cell nucleus directly participates in homologous recombination-mediated DNA repair (PMID: 41196680).