Tested Applications
| Positive WB detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
Product Information
25164-1-AP targets WDR20 in WB, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18353 Product name: Recombinant human WDR20 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-88 aa of BC030654 Sequence: MATEGGGKEMNEIKTQFTTREGLYKLLPHSEYSRPNRVPFNSQGSNPVRVSFVNLNDQSGNGDRLCFNVGRELYFYIYKGVRKAADLS Predict reactive species |
| Full Name | WD repeat domain 20 |
| Calculated Molecular Weight | 569 aa, 63 kDa |
| Observed Molecular Weight | 63 kDa |
| GenBank Accession Number | BC030654 |
| Gene Symbol | WDR20 |
| Gene ID (NCBI) | 91833 |
| RRID | AB_2879934 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8TBZ3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Publications
| Species | Application | Title |
|---|---|---|
Artif Cells Nanomed Biotechnol CircCDYL inhibits the expression of C-MYC to suppress cell growth and migration in bladder cancer. |

