Tested Applications
| Positive WB detected in | HEK-293 cells, Jurkat cells |
| Positive IHC detected in | human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
| IF | See 1 publications below |
Product Information
10115-1-AP targets WDR77 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0147 Product name: Recombinant human WDR77 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 92-342 aa of BC001679 Sequence: RGILVASDSGAVELWELDENETLIVSKFCKYEHDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQVVLSSYRAHAAQVTCVAASPHKDSVFLSCSEDNRILLWDTRCPKPASQIGCSAPGYLPTSLAWHPQQSEVFVFGDENGTVSLVDTKSTSCVLSSAVHSQCVTGLVFSPHSVPFLASLSEDCSLAVLDSSLSELFRSQAHRDFVRDATWSPLNHSLLTTVGWDHQVVHHVVPTEPLPAPGPASVTE Predict reactive species |
| Full Name | WD repeat domain 77 |
| Calculated Molecular Weight | 50 kDa |
| Observed Molecular Weight | 40 kDa |
| GenBank Accession Number | BC001679 |
| Gene Symbol | WDR77 |
| Gene ID (NCBI) | 79084 |
| RRID | AB_2215725 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BQA1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
WDR77, other named p44, MEP-50, is a component of the 20S PRMT5-containing methyltransferase complex, which modifies specific arginines to dimethylarginines in several spliceosomal Sm proteins. Normally, WDR77 locates in the nucleus, such as in prostate epithelial cells. However, it localized to the cytoplasm in prostatic intraepithelial neoplasia and prostate cancer cells. Nuclear WDR77 mediates the growth inhibition and differentiation. WDR may involve in the biogenesis of small nuclear ribonucleoprotein particles.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for WDR77 antibody 10115-1-AP | Download protocol |
| WB protocol for WDR77 antibody 10115-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
EMBO J MST2 methylation by PRMT5 inhibits Hippo signaling and promotes pancreatic cancer progression | ||
Sci Rep Deciphering the prognostic significance of WDR77 in gliomas: a comprehensive analysis |



