WDR8 Polyclonal antibody, PBS Only

• 

  IHC staining of human heart using 27628-1-AP (same clone as 27628-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 27628-1-AP (WDR8 antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 27628-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 27628-1-AP (same clone as 27628-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 27628-1-AP (WDR8 antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 27628-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 27628-1-AP (same clone as 27628-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 27628-1-AP (WDR8 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27628-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 27628-1-AP (same clone as 27628-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 27628-1-AP (WDR8 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27628-1-PBS in a different storage buffer formulation.

WDR8 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 27628-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

27628-1-PBS targets WDR8 in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26267

  Product name: Recombinant human WDR8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 201-413 aa of BC002611

  Sequence: EYKILLYSLDGRLLSTYSAYEWSLGIKSVAWSPSSQFLAVGSYDGKVRILNHVTWKMITEFGHPAAINDPKIVVYKEAEKSPQLGLGCLSFPPPRAGAGPLPSSESKYEIASVPVSLQTLKPVTDRANPKIGIGMLAFSPDSYFLATRNDNIPNAVWVWDIQKLRLFAVLEQLSPVRAFQWDPQQPRLAICTGGSRLYLWSPAGCMSVQVPGE

• Full Name: WD repeat domain 8
• Calculated Molecular Weight: 460 aa, 52 kDa
• GenBank Accession Number: BC002611
• Gene Symbol: WDR8
• Gene ID (NCBI): 49856
• RRID: AB_2880929
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P2S5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.